Recombinant Serpentine receptor class gamma-69 (srg-69)

Shipped with Ice Packs
In Stock

Description

Introduction to Serpentine Receptor Class Gamma-69

Serpentine receptor class gamma-69 (srg-69) is classified as a member of the serpentine receptor family, a diverse group of transmembrane proteins involved in cellular signaling processes. The protein is also known by several synonyms including F09E5.4 and Protein srg-69, which are used interchangeably in scientific literature and commercial databases. Serpentine receptors typically contain seven transmembrane domains and play crucial roles in detecting extracellular signals and facilitating their transmission into intracellular responses. The srg-69 protein specifically belongs to the gamma class of these receptors, suggesting distinct structural and functional characteristics that differentiate it from other serpentine receptor classes.

Protein Structure and Domains

The srg-69 protein, like other serpentine receptors, is characterized by its distinctive seven-transmembrane architecture. This structural arrangement enables the protein to span cell membranes and participate in signal transduction pathways. The protein is identified by the gene designation F09E5.4, indicating its genomic origin and classification within the larger family of serpentine receptors. The specific molecular weight, amino acid sequence, and tertiary structure details would provide valuable insights into the protein's function but require additional research beyond currently available data.

Functional Properties

As a serpentine receptor, srg-69 likely functions as a G-protein coupled receptor (GPCR) involved in detecting extracellular signals and initiating intracellular signaling cascades. The specific ligands that bind to srg-69 and the downstream signaling pathways activated by this receptor remain areas requiring further investigation. Understanding these aspects would significantly enhance our knowledge of srg-69's role in cellular processes and potential applications in biomedical research.

Recombinant Production Methods

Recombinant srg-69 is commercially produced using various expression systems, each offering distinct advantages for specific research applications. Current production platforms include:

  1. Yeast expression systems

  2. Bacterial expression (E. coli)

  3. Baculovirus-infected insect cells

  4. Mammalian cell expression systems

  5. In vivo biotinylation in E. coli

Each expression system may yield proteins with different post-translational modifications, solubility characteristics, and functional properties, allowing researchers to select the most appropriate form for their specific experimental requirements.

Potential Experimental Uses

While specific research applications of srg-69 are not explicitly detailed in the available literature, serpentine receptors generally serve important functions in:

  1. Signal transduction studies

  2. Drug discovery and development

  3. Protein-protein interaction analyses

  4. Structural biology investigations

  5. Cell signaling pathway research

The recombinant srg-69 protein could be particularly valuable in biochemical assays designed to identify potential ligands, characterize binding properties, or elucidate downstream signaling mechanisms.

Model Systems

Serpentine receptors like srg-69 are often studied in model organisms to understand their physiological roles. The F09E5.4 gene designation suggests possible origins in a model organism, though the specific organism is not explicitly mentioned in the available data. Further research into the expression patterns and functional significance of srg-69 in relevant model systems would enhance our understanding of this protein's biological importance.

Protein Quality Assessment

Commercial recombinant srg-69 preparations undergo quality control through SDS-PAGE analysis, confirming a purity level exceeding 85%. This analytical method separates proteins based on molecular weight under denaturing conditions, allowing for assessment of sample homogeneity and purity. Additional characterization methods such as mass spectrometry, circular dichroism, or functional assays would provide more comprehensive quality assessment but are not detailed in the current literature.

Comparative Data Analysis

The table below summarizes the various expression systems used for recombinant srg-69 production and their key characteristics:

Expression SystemCatalog NumberPurityFormAdvantages
YeastBT1620011>85% (SDS-PAGE)Lyophilized powderEukaryotic post-translational modifications
E. coliBT1620011>85% (SDS-PAGE)Lyophilized powderHigh yield, cost-effective
E. coli (Biotinylated)BT1620011>85% (SDS-PAGE)Lyophilized powderSite-specific labeling
BaculovirusBT1620011>85% (SDS-PAGE)Lyophilized powderComplex eukaryotic processing
Mammalian cellBT1620011>85% (SDS-PAGE)Lyophilized powderNative-like modifications

Functional Studies

Future research should focus on identifying the natural ligands for srg-69 and characterizing the signaling pathways activated upon receptor stimulation. Cell-based assays, knockout studies in model organisms, and interactome analyses would help elucidate the physiological roles of this receptor in various biological processes.

Therapeutic Potential

Serpentine receptors represent important targets for drug development, accounting for approximately 34% of all FDA-approved drugs. Investigating srg-69's potential as a therapeutic target would require comprehensive characterization of its expression patterns in different tissues, involvement in disease processes, and druggability assessment through high-throughput screening approaches.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. We kindly recommend contacting your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
srg-69; F09E5.4; Serpentine receptor class gamma-69; Protein srg-69
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-69
Target Protein Sequence
MNSCHPPQDEMAGLIGIYAFQGFYGLLSVVVYTFNIRALRHHKNNLDKSFSLLYTCCAAL SLTYFLDHFLIRRFVKLGFFCEIILENFGEPNYWMMPYKTIASYCPIAILVFHALIAAHR FSIVAAPMRGVQLWDRYRRLFVLVGFLIPLIFMWFMIPCKSYAELDSEGSGGLDIEYKKV FSISSSLAAAIAAVLFGVLTLCLTFGMLIALAKLSLRKLSQAEISLIVFEVFMTVFTLIY AFTQGILYYSIYIVKDMELKSTVIQFRTFAIDIFILPQAWTLLFLSTTVRRYTLRAFGKR LGVEFLSTEIEKSARMVSVAPATISLQKSTVLNYNFTLQNLF
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F09E5.4

STRING: 6239.F09E5.4

UniGene: Cel.28955

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Serpentine receptor class gamma-69 (srg-69)?

Serpentine receptor class gamma-69 (srg-69) belongs to the large superfamily of G-protein-coupled receptors (GPCRs), characterized by seven transmembrane domains forming α-helices that span the cell membrane. Like other serpentine receptors, srg-69 likely contains 25-35 amino acid residues in each transmembrane segment . As a class A GPCR, it would share structural similarities with rhodopsin-like receptors, which comprise approximately 90% of all GPCRs . The structural framework typically includes extracellular N-terminal domains, intracellular C-terminal regions, and interconnecting loops that are critical for ligand binding and signal transduction.

How does srg-69 compare structurally to other serpentine receptor classes?

The srg-69 receptor, as part of the serpentine receptor class gamma family, shares functional homology with other GPCR classes but has distinct structural features. While the core seven-transmembrane architecture is conserved across serpentine receptors, class-specific variations exist in the extracellular and intracellular domains. Unlike the extensively characterized thyroid-stimulating hormone receptor (TSHR) which contains a large extracellular domain (approximately 400 amino acids) , class gamma receptors typically have shorter N-terminal regions. The extracellular loops of srg-69 are likely critical for ligand recognition, whereas the intracellular loops and C-terminal tail would mediate G-protein coupling and downstream signaling cascades.

What expression systems are most effective for producing recombinant srg-69?

Based on protocols established for related serpentine receptors, several expression systems can be employed for recombinant srg-69 production:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growth, high protein yieldsLimited post-translational modifications, inclusion body formation10-50 mg/L
YeastEukaryotic processing, moderate costSome glycosylation patterns differ from mammalian cells5-20 mg/L
BaculovirusMammalian-like post-translational modificationsMore complex, longer production time1-10 mg/L
Mammalian cellsNative-like processing and foldingMost expensive, lower yields0.5-5 mg/L
Cell-free expressionRapid, avoids toxicity issuesLimited post-translational modifications0.1-1 mg/L

For functional studies requiring proper folding and post-translational modifications, mammalian or baculovirus expression systems are recommended, similar to approaches used for srg-5 . These systems facilitate the production of receptor proteins with ≥85% purity as determined by SDS-PAGE analysis .

What purification strategies optimize yield and activity of recombinant srg-69?

A multi-step purification approach is essential for obtaining functional srg-69:

  • Initial extraction: Use mild detergents (DDM, LMNG, or GDN) to solubilize membrane-embedded receptors while preserving native conformation.

  • Affinity chromatography: Implement His-tag or FLAG-tag purification as the primary capture step. For a typical 1L expression culture, use 1-2 mL of affinity resin with overnight binding at 4°C to maximize capture efficiency.

  • Size-exclusion chromatography: Apply subsequent purification to remove aggregates and improve homogeneity. A flow rate of 0.5 mL/min through Superdex 200 columns typically yields the best resolution for serpentine receptors.

  • Stability optimization: Incorporate cholesterol hemisuccinate (CHS) at 0.1% w/v in all buffers to enhance receptor stability throughout purification.

This strategy typically achieves ≥85% purity as determined by SDS-PAGE analysis, consistent with standards reported for other recombinant serpentine receptors .

How can researchers verify proper folding and functionality of recombinant srg-69?

Proper folding and functionality verification requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: Confirm α-helical content characteristic of GPCRs, with negative bands at 208 and 222 nm.

  • Thermal stability assays: Implement fluorescence-based thermal shift assays using CPM (7-diethylamino-3-(4-maleimidophenyl)-4-methylcoumarin) to determine melting temperature (Tm) values.

  • Ligand binding assays: Develop radioligand or fluorescent ligand binding assays to calculate affinity constants (Kd) and maximal binding capacity (Bmax).

  • G-protein coupling assays: Assess G-protein activation through GTPγS binding or BRET-based assays to confirm signal transduction functionality.

  • Microscale thermophoresis (MST): Evaluate ligand binding in near-native conditions with minimal protein consumption.

For GPCRs like srg-69, functional coupling to G-proteins is essential to confirm biological activity, as heterotrimeric G-proteins formed by Gα, Gβ, and Gγ subunits transduce extracellular signals to intracellular effectors .

How can researchers identify signaling pathways activated by srg-69?

Comprehensive pathway identification requires systematic experimental approaches:

  • G-protein subtype coupling: Determine which Gα subtypes (Gs, Gi/o, Gq/11, G12/13) interact with srg-69 using BRET assays or IP accumulation, cAMP, or RhoA activation measurements.

  • Second messenger analysis: Quantify changes in key second messengers (cAMP, cGMP, Ca²⁺, IP3) following receptor activation . Use biosensors with appropriate positive controls for each pathway.

  • Phosphorylation cascades: Implement phospho-specific antibodies and kinase inhibitors to map downstream effectors such as ERK1/2, p38 MAPK, and Akt.

  • Arrestin recruitment: Evaluate arrestin coupling using BRET or FRET-based approaches to assess potential G-protein-independent signaling.

  • Transcriptional responses: Perform RNA-seq analysis comparing wild-type and knockdown/knockout models to identify genes differentially regulated following receptor activation, similar to approaches used for other GPCRs .

These methods will help establish the signaling profile of srg-69, which likely includes heterotrimeric G-protein activation leading to modulation of effectors such as adenylyl cyclases, guanylyl cyclases, or phospholipase C .

What strategies are effective for studying ligand-receptor interactions for srg-69?

Multiple complementary approaches enable detailed characterization of ligand-receptor interactions:

  • Homology modeling and docking: Develop computational models based on structurally characterized GPCRs to predict binding pockets and ligand interactions.

  • Site-directed mutagenesis: Systematically mutate predicted binding site residues to confirm their role in ligand recognition.

  • Cross-linking studies: Implement photoaffinity labeling with modified ligands to identify specific contact points.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational changes induced by ligand binding.

  • Cryo-EM analysis: For higher-resolution structural insights, purify the receptor in complex with stabilizing nanobodies or G-proteins.

Based on studies of other class A GPCRs, critical binding determinants likely reside within the transmembrane helices and extracellular loops . Structural changes upon activation typically involve rearrangements of TM5, TM6, and TM7 domains, as observed in related receptors .

What are the most common challenges in srg-69 expression and how can they be addressed?

Researchers frequently encounter several obstacles when expressing recombinant serpentine receptors:

ChallengePotential SolutionsImplementation Notes
Low expression levelsOptimize codon usage for expression system; use stronger promotersConsider synthesizing genes with codon adaptation index >0.8
Protein misfoldingInclude chemical chaperones (DMSO, glycerol); lower expression temperatureReduce temperature to 16-18°C during induction phase
AggregationScreen detergent conditions; add stabilizing ligandsTest a matrix of 6-8 detergents at varying concentrations
Proteolytic degradationAdd protease inhibitors; remove/mutate protease sitesInclude complete protease inhibitor cocktail in all buffers
Poor solubilizationOptimize detergent:protein ratio; try detergent mixturesInitial screening should include DDM, LMNG, and GDN
Low activityInclude lipids during purification; stabilize with nanobodiesAdd brain lipid extract (0.1-0.2 mg/mL) to purification buffers

Glycosylation sites may be particularly important for proper expression and function of serpentine receptors like srg-69, as demonstrated for TSHR which requires glycosylation at multiple sites for functional expression .

How should researchers design experiments to determine the physiological role of srg-69?

A systematic experimental design should include:

  • Expression profiling: Quantify srg-69 expression across different tissues and developmental stages using RT-qPCR and immunohistochemistry.

  • Genetic manipulation: Implement CRISPR/Cas9-mediated knockout or knockdown approaches, followed by phenotypic analysis.

  • Rescue experiments: Reintroduce wild-type or mutant srg-69 into knockout models to confirm specificity of observed phenotypes.

  • Signaling pathway analysis: Compare activation of downstream effectors in wild-type versus manipulated systems.

  • Physiological readouts: Develop assays specific to the biological system where srg-69 is expressed.

  • Interaction studies: Identify protein-protein interactions using approaches such as co-immunoprecipitation, proximity labeling, or yeast two-hybrid screening.

How does srg-69 compare functionally to other serpentine receptor class gamma members?

Comparative analysis of serpentine receptor class gamma members reveals both conserved and divergent features:

  • Sequence homology: Class gamma receptors like srg-5 and srg-69 share conserved transmembrane domains but may differ substantially in their extracellular loops and N-terminal regions .

  • G-protein coupling preferences: Within the class gamma family, different members may preferentially couple to distinct G-protein subtypes, leading to activation of different signaling cascades.

  • Ligand selectivity: The extracellular domains and binding pockets show evolutionary diversification, allowing different receptors to recognize distinct ligands despite structural similarities.

  • Expression patterns: Class gamma receptors often display tissue-specific expression patterns, suggesting specialized physiological roles in different biological contexts.

  • Regulatory mechanisms: Post-translational modifications, internalization rates, and desensitization pathways may vary among family members.

Researchers exploring srg-69 should consider these comparative aspects to understand both the conserved functional mechanisms shared across class gamma receptors and the unique features that define srg-69's specific biological role.

What evolutionary insights can be gained from studying srg-69 across species?

Evolutionary analysis of srg-69 can reveal:

  • Phylogenetic conservation: The degree of sequence conservation across species provides insights into functional importance and evolutionary pressure.

  • Domain evolution: Analysis of transmembrane domains versus extracellular/intracellular regions often reveals differential evolutionary rates, with core signaling machinery typically more conserved than ligand-binding domains.

  • Species-specific adaptations: Comparing srg-69 orthologs can identify species-specific modifications that may correlate with environmental adaptations or physiological differences.

  • Gene duplication events: Identifying paralogs within species helps reconstruct the evolutionary history and potential functional diversification.

  • Selection pressures: Computing dN/dS ratios identifies regions under positive or purifying selection, providing insights into functional constraints.

For effective cross-species comparison, researchers should align sequences using tools optimized for multi-transmembrane proteins and consider generating homology models based on structurally characterized GPCRs.

How should researchers interpret conflicting data in srg-69 signaling pathway studies?

When encountering conflicting data in signaling pathway studies:

  • Experimental context analysis: Carefully evaluate differences in cell types, expression systems, or assay conditions that might explain disparate results.

  • Receptor expression levels: Assess whether differences in receptor density might trigger different signaling outcomes through mechanisms like receptor clustering or differential G-protein coupling.

  • Temporal dynamics: Consider whether signaling measurements were taken at different time points, potentially capturing different phases of a complex signaling cascade.

  • Pathway crosstalk: Investigate potential crosstalk between signaling pathways that might be differentially regulated in different experimental systems.

  • Receptor states: Evaluate whether the conflicting data might represent different active conformations of the receptor coupled to different downstream effectors.

  • Methodological validation: Implement multiple complementary techniques to measure the same signaling outcome, similar to approaches used in studying other GPCRs .

This systematic approach helps reconcile seemingly contradictory findings and may reveal complex signaling behaviors characteristic of GPCRs, which can couple to multiple G-protein subtypes and trigger diverse signaling cascades.

What statistical approaches are most appropriate for analyzing srg-69 binding and signaling data?

Rigorous statistical analysis of binding and signaling data requires:

  • Dose-response modeling: Apply non-linear regression to fit appropriate models (four-parameter logistic equation for sigmoidal responses) to determine EC50/IC50 values with 95% confidence intervals.

  • Binding kinetics analysis: Use global fitting approaches for association/dissociation experiments to determine kon and koff rates simultaneously.

  • Bias quantification: Implement operational models to calculate transduction coefficients (log(τ/KA)) for comparing efficacy across different signaling pathways.

  • Allosteric modulation analysis: Apply extended allosteric models to quantify cooperativity factors (α, β) when studying modulators.

  • Replicate design: Include both technical replicates (same sample measured multiple times) and biological replicates (independent experiments) to address different sources of variability.

  • Normalization strategies: Carefully select appropriate controls for normalization, and document all data transformations.

For signaling pathway analysis similar to those conducted with other GPCRs, consider implementing linear mixed models when analyzing data with multiple variables and potential random effects .

What emerging technologies will advance srg-69 research in the next five years?

Several cutting-edge technologies will transform srg-69 research:

  • Cryo-electron microscopy: Advances in single-particle cryo-EM will enable structural determination of srg-69 in complex with signaling partners at near-atomic resolution without crystallization.

  • Integrated structural biology: Hybrid approaches combining HDX-MS, cross-linking MS, cryo-EM, and computational modeling will provide comprehensive structural insights.

  • Advanced genome editing: Prime editing and base editing technologies will enable precise manipulation of srg-69 in its native genomic context.

  • Spatial transcriptomics and proteomics: These techniques will map srg-69 expression and signaling components with unprecedented spatial resolution in tissues.

  • Artificial intelligence: Deep learning approaches will enhance homology modeling, virtual screening, and prediction of ligand-receptor interactions.

  • Single-cell signaling analysis: New biosensors and microfluidic platforms will enable detailed characterization of srg-69 signaling at the single-cell level.

  • Organoid models: Advanced 3D culture systems will provide more physiologically relevant contexts for studying srg-69 function.

These technologies will facilitate understanding of conformational dynamics, signaling complexes, and physiological functions of srg-69 in increasingly native-like environments.

What are the most promising therapeutic applications targeting srg-69?

Though therapeutic applications would depend on the physiological role of srg-69, several approaches show general promise for GPCR-targeted therapeutics:

  • Biased ligand development: Design compounds that selectively activate beneficial signaling pathways while minimizing unwanted effects.

  • Allosteric modulators: Develop positive or negative allosteric modulators that fine-tune receptor activity rather than simply activating or blocking it.

  • Antibody-based therapeutics: Engineer antibodies or nanobodies that specifically target extracellular epitopes of srg-69.

  • RNA therapeutics: Design antisense oligonucleotides or siRNAs to modulate srg-69 expression with high specificity.

  • Protein-protein interaction disruptors: Target specific interactions between srg-69 and downstream signaling partners.

Based on experience with other GPCRs, which represent targets for approximately 40% of approved drugs currently in use , developing highly selective compounds with optimized pharmacokinetic properties remains a significant challenge but offers substantial therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.