Recombinant Serpentine receptor class gamma-6 (srg-6)

Shipped with Ice Packs
In Stock

Description

  • Tags: N-terminal or C-terminal tags are used for stability and purification, though specific types depend on production conditions .

  • Applications: Primarily used in C. elegans research and vaccine development .

GPCR Activation and Trafficking

Studies on yeast GPCRs (e.g., α-factor receptor) highlight the role of proline residues in TMD VI in stabilizing inactive conformations and ensuring proper trafficking to the plasma membrane . Mutations in analogous residues may lead to:

  • Constitutive Activation: Destabilization of the inactive state, triggering G protein signaling without ligand binding .

  • Intracellular Retention: Mutant receptors may accumulate in post-ER compartments due to misfolding .

Though not explicitly demonstrated for srg-6, these mechanisms suggest conserved regulatory pathways among serpentine receptors.

Sequence Conservation and Potential Ligands

srg-6 shares sequence motifs with other nematode serpentine receptors, including:

  • Extracellular Domains: Likely involved in ligand recognition.

  • Intracellular Loops: Critical for G protein coupling.

No endogenous ligands have been identified for srg-6, but its structural similarity to chemosensory receptors suggests potential roles in environmental sensing or developmental signaling .

Applications in Research and Development

srg-6 is utilized in:

  1. C. elegans Model Studies: Investigating receptor-mediated signaling in nematode development and behavior .

  2. Vaccine Development: Preclinical studies leveraging recombinant srg-6 for immunogenicity testing .

Future Directions

Further research is needed to:

  • Elucidate Biological Function: Identify ligands and downstream signaling pathways.

  • Optimize Production: Improve yield and stability for therapeutic applications.

  • Explore Pharmacological Targets: Assess potential for drug development.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
srg-6; T12A2.13; Serpentine receptor class gamma-6; Protein srg-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-6
Target Protein Sequence
MANSTSFLGCSRFYATFEENLKLMGQLVYLIPSFILISKMIYVIQVKHRGDYHEQRRFWL LYTMDLALSLLNLFFDIFYYRLTLFVPQICESFSFFLRANPLLIDITYPLWFYFHVGKMV AQMSISFERMTFNLLKPNDYRRIWKHGLTACVIMIIFVPFSIIWNILISDKYIQFYFGGF QPNYSRRVNWFGTTAWQLTYMQISMAVTLLSNIVTGAILWKSQNQSRKSRLLCRIWFAIS TEYLLSACAFCYLHMKTFAFDYSNLIFMLVIFVWDGFNILSPVIMISMNKSLRKQVFAMS GGSEDLEISVA
Uniprot No.

Target Background

Database Links
Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine Receptor Class Gamma-6 (srg-6) and what organism is it native to?

Serpentine Receptor Class Gamma-6 (srg-6) is a protein expressed in Caenorhabditis elegans. It belongs to the serpentine receptor class gamma family, which are G protein-coupled receptors (GPCRs) that typically contain seven transmembrane domains. The full-length protein consists of 311 amino acids and can be recombinantly produced with tags such as His-tag for research purposes . The receptor is part of the large family of chemosensory receptors in C. elegans, which are involved in detecting environmental chemical cues and mediating behavioral responses to these stimuli.

What are the main structural characteristics of srg-6?

The srg-6 protein exhibits the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors. The full-length protein spans 311 amino acids in C. elegans . When produced recombinantly, it can be expressed with various tags (such as His-tag) to facilitate purification and detection in experimental settings. The protein's three-dimensional structure includes extracellular domains that likely serve as binding sites for ligands, transmembrane regions that anchor the protein in the cell membrane, and intracellular domains that interact with G proteins to initiate downstream signaling cascades upon receptor activation.

What cellular pathways is srg-6 known to participate in?

The specific pathways involving srg-6 are still being investigated, as comprehensive pathway information is not fully established in the current literature . As a serpentine receptor, it likely functions in signal transduction pathways involving G protein activation, leading to second messenger generation and subsequent cellular responses. These pathways typically involve the modulation of ion channels, enzymatic activities, or gene expression. The receptor may participate in chemosensation pathways in C. elegans, potentially mediating responses to specific environmental chemicals or pheromones that are important for the organism's behavior and survival.

How should I design experiments to study srg-6 function in C. elegans?

When designing experiments to study srg-6 function, consider implementing a multi-faceted approach that combines genetic, behavioral, and molecular techniques. Begin by obtaining or generating srg-6 mutant strains (knockout, knockdown, or overexpression) to compare with wild-type worms. Design behavioral assays that test chemotaxis, avoidance, or other sensory-related behaviors to detect phenotypic differences between wild-type and mutant strains. Complement these with cell-specific expression studies using fluorescent reporters fused to the srg-6 promoter to identify the cells in which srg-6 is expressed. For molecular interaction studies, consider using techniques such as co-immunoprecipitation or yeast two-hybrid screens to identify proteins that interact with srg-6 . Implement controlled environmental conditions throughout experiments, as C. elegans behaviors are sensitive to temperature, humidity, and food availability.

What are the optimal expression systems for producing recombinant srg-6 protein?

Recombinant srg-6 protein can be effectively produced using E. coli expression systems, as evidenced by available recombinant products . When designing your expression protocol, consider using BL21(DE3) or Rosetta strains of E. coli, which are optimized for recombinant protein expression. For membrane proteins like srg-6, it may be beneficial to use specialized E. coli strains that enhance membrane protein expression or to include solubilizing tags. Alternative expression systems such as insect cells (Sf9 or Hi5 cells with baculovirus vectors) or mammalian cells (HEK293 or CHO cells) might provide protein with more native-like post-translational modifications. The choice of expression system should be guided by the specific experimental requirements, such as protein yield, purity, folding, and functionality needs.

What purification strategies are most effective for recombinant srg-6?

For effective purification of recombinant srg-6, a multi-step approach is recommended. Begin with affinity chromatography using the His-tag that is commonly incorporated in recombinant srg-6 constructs . This initial step can be performed using nickel or cobalt resin columns under native or denaturing conditions, depending on protein solubility. Follow with size exclusion chromatography to separate aggregates from properly folded protein and to improve purity. For membrane proteins like srg-6, include detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin throughout the purification process to maintain protein solubility and native conformation. If higher purity is required, consider incorporating ion exchange chromatography as an additional step. Validate the quality of purified protein using SDS-PAGE, Western blotting, and functional assays to ensure that the purification process yields biologically active srg-6.

How can genome editing technologies be applied to study srg-6 function in vivo?

Genome editing technologies, particularly CRISPR-Cas9, offer powerful approaches to investigate srg-6 function in C. elegans. Design guide RNAs targeting specific regions of the srg-6 gene to create precise knockout or knockin mutations. For functional studies, consider creating point mutations in conserved domains to identify critical residues for ligand binding or G-protein coupling. Fluorescent protein tags can be inserted at the C-terminus to monitor expression patterns and subcellular localization without disrupting function. For temporal control, implement conditional knockout systems such as auxin-inducible degradation or tissue-specific promoters driving Cas9 expression. When designing CRISPR experiments, include appropriate controls and verification steps, such as sequencing to confirm edits and rescue experiments to validate phenotypes. Consider the ethical implications and containment requirements when creating genetically modified organisms, and maintain detailed records of all genetic modifications in accordance with institutional guidelines .

What are the current challenges in identifying ligands for srg-6?

Identifying ligands for orphan receptors like srg-6 presents several methodological challenges. Traditional approaches such as radioligand binding assays may have limited applicability due to the lack of known ligands that could serve as starting points. To overcome these limitations, implement more advanced screening strategies such as functional cell-based assays that measure downstream signaling events (calcium flux, cAMP production, or reporter gene activation) when candidate ligands activate the receptor. Consider using computational approaches such as molecular docking or pharmacophore modeling to predict potential ligands based on the receptor's structure. Another approach is to conduct unbiased screens using complex mixtures (tissue extracts, chemical libraries) followed by fractionation and identification of active components. Validate potential ligands through dose-response experiments, competitive binding assays, and in vivo studies in C. elegans to confirm biological relevance. The challenges also include the proper expression and folding of the receptor in heterologous systems, which may require optimization of expression conditions or the use of receptor chimeras .

How can structural biology techniques be applied to elucidate srg-6 structure-function relationships?

Structural biology techniques offer valuable insights into srg-6's molecular architecture and function. Begin with homology modeling based on structurally characterized GPCRs to generate initial structural predictions. For experimental structure determination, consider X-ray crystallography, which typically requires protein engineering to enhance crystallizability (e.g., creating fusion proteins, removing flexible regions, or introducing stabilizing mutations). Alternatively, cryo-electron microscopy (cryo-EM) may be suitable for determining the structure without crystallization, especially when srg-6 is incorporated into nanodiscs or other membrane mimetics. Nuclear magnetic resonance (NMR) spectroscopy can provide information about dynamic regions and ligand binding sites, particularly for isolated domains. Complement structural studies with molecular dynamics simulations to understand conformational changes during activation. Site-directed mutagenesis based on structural insights can identify key residues involved in ligand binding or signal transduction. The structural data should be integrated with functional assays to establish structure-function relationships and potentially guide the design of specific agonists or antagonists for srg-6.

What statistical approaches are recommended for analyzing srg-6 expression data?

When analyzing srg-6 expression data, robust statistical methodologies are essential for accurate interpretation. For quantitative PCR data, employ the ΔΔCt method with appropriate reference genes, validated for stability across experimental conditions. Implement normality tests (Shapiro-Wilk or Kolmogorov-Smirnov) to determine whether parametric or non-parametric tests are appropriate. For comparing expression levels across multiple conditions, use ANOVA followed by post-hoc tests (Tukey's or Dunnett's) for parametric data, or Kruskal-Wallis followed by Dunn's test for non-parametric data. For time-course experiments, consider repeated measures ANOVA or mixed-effects models. When analyzing RNA-seq data, apply appropriate normalization methods (TPM, RPKM, or DESeq2 normalization) before differential expression analysis. Include power analysis during experimental design to ensure sufficient sample sizes for detecting biologically meaningful differences. Present data with appropriate visualizations (box plots, violin plots) that display both the central tendency and distribution of the data. Report effect sizes along with p-values to convey the magnitude of observed differences in srg-6 expression across conditions.

How should researchers interpret contradictory findings in srg-6 functional studies?

When confronted with contradictory findings in srg-6 functional studies, implement a systematic approach to reconciliation. First, critically evaluate methodological differences between studies, including genetic backgrounds, environmental conditions, assay sensitivity, and reagent specificity. Consider whether discrepancies might result from context-dependent functions of srg-6 in different tissues, developmental stages, or environmental conditions. Examine differences in the specific mutations or manipulations used to alter srg-6 function, as different mutations might affect distinct functional domains. Design validation experiments that directly address contradictions, ideally combining multiple methodological approaches. Collaborate with laboratories reporting conflicting results to perform side-by-side comparisons under identical conditions. Consider biological redundancy with other serpentine receptors that might compensate for srg-6 loss in some genetic backgrounds but not others. When publishing, transparently discuss contradictions with existing literature and propose testable hypotheses to explain differences. Remember that apparent contradictions often lead to more nuanced understanding of complex biological systems and may ultimately reveal important regulatory mechanisms or context-dependent functions of srg-6.

What bioinformatic tools are most useful for comparative analysis of srg-6 across species?

For comparative analysis of srg-6 across species, utilize a comprehensive suite of bioinformatic tools. Begin with sequence alignment tools like MUSCLE, CLUSTAL Omega, or T-Coffee to align srg-6 orthologs, followed by phylogenetic analysis using maximum likelihood (RAxML, PhyML) or Bayesian inference (MrBayes) methods to reconstruct evolutionary relationships. For identifying conserved functional domains, use InterProScan, SMART, or Pfam, and visualize conservation patterns with tools like WebLogo or ConSurf. Homology modeling platforms such as SWISS-MODEL or I-TASSER can predict three-dimensional structures based on crystallized GPCRs, while molecular dynamics simulations using GROMACS or NAMD can explore structural conservation in membrane environments. For genomic context analysis, utilize tools like SyntenyTracker or MCScanX to identify syntenic regions and genomic rearrangements affecting srg-6 loci across species. Gene coevolution analysis using methods such as mutual information analysis or correlation-based approaches can identify potentially interacting partners that have co-evolved with srg-6. Integrate data from multiple sources using platforms like Cytoscape to visualize and analyze networks of evolutionary and functional relationships involving srg-6 and related proteins.

What are common challenges in achieving functional expression of recombinant srg-6?

Achieving functional expression of recombinant srg-6 presents several challenges that require systematic troubleshooting. Membrane proteins like serpentine receptors often encounter folding difficulties in heterologous expression systems, resulting in aggregation or retention in inclusion bodies. To address this, optimize expression conditions by testing different E. coli strains, expression temperatures (typically lowering to 16-18°C), and induction parameters . Consider using specialized E. coli strains designed for membrane protein expression or fusion partners that enhance solubility (such as MBP, GST, or SUMO). If E. coli expression yields primarily non-functional protein, transition to eukaryotic expression systems like yeast, insect cells, or mammalian cells, which provide more sophisticated membrane insertion and folding machinery. For extraction and purification, evaluate different detergents systematically (ranging from harsh ionic detergents to milder non-ionic ones) to identify conditions that maintain native conformation. Verify protein functionality through ligand binding assays or functional reconstitution into liposomes or nanodiscs. Monitor protein quality at each step using techniques such as circular dichroism to assess secondary structure and size exclusion chromatography to evaluate aggregation state.

How can researchers overcome specificity issues in srg-6 detection assays?

Overcoming specificity issues in srg-6 detection requires careful antibody validation and assay optimization. When developing antibodies against srg-6, select antigenic epitopes unique to this protein by performing thorough sequence alignment against related serpentine receptors. Validate commercial antibodies through multiple approaches, including Western blotting with positive controls (recombinant srg-6) and negative controls (samples from srg-6 knockout organisms). Implement peptide competition assays to confirm binding specificity. For immunohistochemistry or immunofluorescence, include appropriate controls and cross-validate with orthogonal detection methods such as in situ hybridization or expression of tagged srg-6 constructs. If antibody-based detection proves challenging, consider alternative approaches such as CRISPR-mediated endogenous tagging with epitope tags or fluorescent proteins. For PCR-based detection of srg-6 transcripts, design primers spanning exon-exon junctions to avoid genomic DNA amplification and validate primer specificity through sequencing of amplification products. Regardless of the detection method, establish clear criteria for positive identification and implement blinded analysis to minimize confirmation bias in interpretation of results.

What are the prospects for developing srg-6 modulators as research tools?

Developing specific modulators (agonists or antagonists) for srg-6 would provide valuable research tools for dissecting its biological functions. Begin with in silico approaches such as virtual screening of compound libraries against homology models of srg-6, focusing on predicted ligand-binding pockets. Structure-activity relationship studies using related receptors with known ligands can guide the design of potential srg-6 modulators. Implement high-throughput screening assays in heterologous expression systems, using readouts such as calcium mobilization, β-arrestin recruitment, or receptor internalization to identify compounds that activate or inhibit srg-6 signaling. Iterative medicinal chemistry optimization can improve potency, selectivity, and physicochemical properties of initial hits. Evaluate promising compounds in C. elegans behavioral assays to confirm in vivo activity and specificity. Consider developing photoaffinity probes or biotinylated derivatives for target engagement studies. Beyond small molecules, explore alternative modulator formats such as peptides, nanobodies, or aptamers that might offer unique advantages in targeting specific conformational states or domains of srg-6. The development of such tools would enable precise temporal control of srg-6 activity in vivo, complementing genetic approaches and potentially revealing acute versus developmental roles of this receptor.

How might integrating srg-6 research with systems biology approaches enhance our understanding of sensory perception in C. elegans?

Integrating srg-6 research with systems biology approaches can provide holistic insights into C. elegans sensory perception networks. Construct comprehensive signaling networks by combining transcriptomics, proteomics, and metabolomics data from wild-type and srg-6 mutant worms under various sensory stimuli. Apply machine learning algorithms to identify patterns in high-dimensional behavioral data, potentially revealing subtle phenotypes associated with srg-6 function that might be missed in traditional assays. Develop mathematical models of srg-6 signaling dynamics, incorporating parameters such as ligand binding kinetics, receptor desensitization, and downstream effector activation. These models can generate testable predictions about system behavior under different conditions. Implement genome-scale genetic interaction screens (e.g., using RNAi or CRISPR) to identify genes that functionally interact with srg-6, revealing potential redundancies or compensatory mechanisms. Connect srg-6 function to broader physiological processes through meta-analysis of published datasets, looking for correlations between srg-6 expression/activity and organismal phenotypes such as longevity, stress resistance, or reproductive capacity. Apply network theory to position srg-6 within the broader context of C. elegans sensory systems, potentially identifying its role as a hub or peripheral component in information processing networks. This systems-level understanding could reveal how individual chemosensory receptors like srg-6 contribute to the remarkable sensory capabilities of C. elegans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.