Recombinant Serpentine receptor class gamma-7 (srg-7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
srg-7; C18F10.8; Serpentine receptor class gamma-7; Protein srg-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-7
Target Protein Sequence
MASSPPIYNLEQYGTNCSEEYSNFYENSKYWIQCLWLIPTLFLLVWIIITTRVRYPSQYS NLPYWILTADCVVSIILILLDLFVVRLFLYFPQLCSKFSTIFINYPIISDIYFPIYNYAR VFKTGSQCGMILSRLFCVLIPFGHDEKLRRHIPLFLTIICILPILVVWNTVISEKEVVFW YGGFFVIYHRRVGWVSLSKLHLTFIFVSISFILISSLLLMRHLPIESAVNAERRVITNSI FIIVAFFFQAAFQSFYAFFRYTDWYPRFLVDFQFIIYDVMTVGYPLIFLNFAKEFRNHVF LKSNRKGRTLMELRSMSKPFNNTMPRQESPSPNYDSILA
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C18F10.8

UniGene: Cel.24376

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class gamma-7 (srg-7) and what organism is it found in?

Serpentine receptor class gamma-7 (srg-7) is a protein-coding gene found in the nematode Caenorhabditis elegans . It belongs to the larger family of serpentine receptors, which are membrane proteins characterized by seven transmembrane domains. The gene has been assigned the Entrez Gene ID 191833 and encodes a protein product identified as NP_498371.1, which is translated from the mRNA sequence NM_065970.1 . The complete open reading frame (ORF) of srg-7 consists of 1020 base pairs that code for the full protein sequence . As a member of the serpentine receptor family, srg-7 likely functions as a G protein-coupled receptor (GPCR) involved in signal transduction pathways, although its specific ligands and downstream signaling targets require further characterization.

What are the structural characteristics of the srg-7 protein?

The srg-7 protein, like other serpentine receptors, is characterized by its seven transmembrane domain structure, which is typical of G protein-coupled receptors. The complete protein sequence (NP_498371.1) is translated from the 1020 bp open reading frame . While the specific 3D structure of srg-7 has not been detailed in the available search results, serpentine receptors generally contain an extracellular N-terminus, seven alpha-helical transmembrane domains connected by alternating intracellular and extracellular loops, and an intracellular C-terminus. Based on research on similar receptors like PfSR12, we can infer that the structural domains of srg-7 likely play crucial roles in its function, potentially including ligand binding in the extracellular or transmembrane regions and G-protein coupling at the intracellular loops and C-terminus . The specific amino acid sequence of srg-7 would determine its unique binding properties and signaling characteristics.

What are the most effective methods for recombinant expression of srg-7?

For recombinant expression of srg-7, researchers should consider a multifaceted approach that accounts for the challenges associated with membrane protein expression. The srg-7 gene can be effectively cloned into expression vectors such as pcDNA3.1+/C-(K)DYK, which is designed for mammalian expression systems and includes a C-terminal DYKDDDDK tag for detection and purification purposes . For the cloning process, seamless cloning technologies such as CloneEZ™ are recommended to ensure precise insertion of the 1020 bp ORF sequence without introducing unwanted mutations . When selecting an expression system, HEK293 cells have proven effective for serpentine receptors based on research with similar proteins . Expression conditions should be optimized by testing various incubation times (24-72 hours) and temperatures (30-37°C), as lower temperatures may improve proper folding of membrane proteins. Verification of successful expression should include Western blotting to confirm protein size and ELISA methods to quantify surface expression levels, similar to approaches used for PfSR12 .

How can researchers address challenges in purification and stabilization of recombinant srg-7?

Purification and stabilization of recombinant srg-7 presents significant challenges due to its hydrophobic transmembrane domains. To address these challenges, researchers should employ a strategic approach beginning with optimal detergent selection. A detergent screen including mild non-ionic detergents (DDM, LMNG) and zwitterionic detergents (CHAPS, FC-12) should be conducted to identify conditions that maintain protein stability while effectively solubilizing the membrane-bound receptor. Affinity chromatography utilizing the C-terminal DYKDDDDK tag can be employed for initial purification , followed by size exclusion chromatography to remove aggregates and achieve higher purity. For long-term stability, researchers should consider incorporating cholesterol or specific lipids during purification that mimic the native membrane environment. Alternatively, novel approaches such as styrene-maleic acid lipid particles (SMALPs) or nanodiscs may be employed to maintain srg-7 in a more native-like lipid environment. Throughout the purification process, stability should be monitored using thermal shift assays and functional binding studies to ensure the purified protein retains its native conformation and activity.

What cellular localization methods are most suitable for studying srg-7 expression patterns?

For studying srg-7 cellular localization, researchers should implement complementary approaches to ensure comprehensive characterization. Fluorescent tagging with GFP or mCherry at the C-terminus of srg-7 (avoiding N-terminal tags that might interfere with signal peptides) allows for real-time visualization in live C. elegans using confocal microscopy. For fixed samples, immunohistochemistry using antibodies against the DYKDDDDK tag of recombinant srg-7 provides high-specificity detection . Subcellular fractionation followed by Western blotting can quantitatively determine distribution between membrane, cytoplasmic, and other cellular compartments. For highest resolution imaging, super-resolution microscopy techniques such as STORM or PALM can resolve srg-7 localization within specific membrane microdomains. When examining trafficking dynamics, photoactivatable fluorescent proteins or pulse-chase experiments may reveal transport mechanisms. Additionally, co-localization studies with known membrane markers (e.g., ER, Golgi, plasma membrane markers) should be performed to precisely define the trafficking pathway. This comprehensive approach will provide both qualitative and quantitative assessment of srg-7 expression patterns throughout C. elegans tissues and subcellular compartments.

What signaling pathways are activated by srg-7 and how can they be measured?

While the specific signaling pathways activated by srg-7 have not been directly characterized in the available search results, research on other serpentine receptors provides a framework for investigation. Based on studies of serpentine receptors like PfSR12, srg-7 likely couples to G proteins and may activate multiple downstream pathways . To characterize these pathways, researchers should implement bioluminescence resonance energy transfer (BRET)-based biosensors that can detect various second messengers. For G protein coupling specificity, BRET assays measuring the dissociation of Gα from Gβγ subunits upon receptor activation should be utilized with different G protein subtypes (Gq/11, Gi/o, Gs, G12/13) . To assess downstream signaling, calcium mobilization can be measured using Obelin-based biosensors, while diacylglycerol (DAG) formation and protein kinase C (PKC) activation can be detected with specific BRET-based sensors as demonstrated for PfSR12 . Additionally, cyclic AMP (cAMP) production should be measured using EPAC biosensors to determine if srg-7 couples to Gs or Gi pathways . These functional assays should be conducted in heterologous expression systems with appropriate controls, including known G protein inhibitors like YM-254890 for Gq/11 , to confirm pathway specificity.

What methods can be used to identify potential ligands for srg-7?

Identifying potential ligands for srg-7 requires a systematic approach combining computational prediction with experimental validation. Initially, researchers should employ in silico methods including homology modeling of srg-7's binding pocket based on related GPCRs with known structures, followed by virtual screening of compound libraries to identify candidate ligands. This computational approach should be complemented by experimental strategies including high-throughput screening using calcium mobilization assays in srg-7-expressing cells , as calcium flux is a common readout for GPCR activation. Additionally, researchers should implement direct binding assays using purified recombinant srg-7 with radiolabeled or fluorescently labeled candidate ligands to determine binding affinities. For unbiased discovery, metabolomics approaches examining C. elegans extracts coupled with activity-guided fractionation can identify native ligands. Given that serpentine receptors like PfSR12 can influence the expression and function of other GPCRs , screening should account for potential indirect effects. Finally, in vivo validation using C. elegans behavioral assays with srg-7 mutants versus wild-type animals exposed to candidate ligands can confirm physiological relevance. This multi-faceted approach increases the likelihood of identifying true srg-7 ligands despite the challenging nature of orphan receptor deorphanization.

What controls should be included when studying srg-7 function in heterologous expression systems?

When studying srg-7 function in heterologous expression systems, a comprehensive set of controls is essential to ensure reliable data interpretation. First, researchers should include empty vector transfections as negative controls to account for endogenous receptor responses in the host cell line . Second, positive control receptors with well-characterized signaling profiles should be included, such as muscarinic type 3 receptor (M3R) for Gq pathways or dopamine receptor D2R for Gi/o pathways, as demonstrated in PfSR12 studies . Third, pharmacological controls using pathway-specific inhibitors such as YM-254890 for Gq/11 inhibition should be employed to confirm signaling specificity . Fourth, knockout cell lines for specific G protein subunits with subsequent rescue experiments through G protein re-expression provide definitive evidence for pathway engagement, as shown with Gq/11 knockout HEK293 cells . Fifth, concentration-response curves with reference ligands should be performed to characterize pharmacological parameters. Sixth, expression level controls using Western blotting and surface ELISA are crucial to normalize functional responses to receptor expression levels . Finally, time course experiments should be conducted to capture both rapid signaling events and potential receptor desensitization. This systematic approach to controls ensures that observed effects can be confidently attributed to srg-7 activity rather than experimental artifacts or endogenous cellular components.

How can researchers develop effective C. elegans models for studying srg-7 function in vivo?

Developing effective C. elegans models for studying srg-7 function requires a strategic approach combining genetic engineering with behavioral and physiological assays. Researchers should begin by generating multiple srg-7 mutant lines using CRISPR-Cas9 to create null alleles, point mutations in key functional domains, and conditional knockouts. Complementing these loss-of-function models, transgenic lines overexpressing wild-type or tagged srg-7 under its endogenous promoter should be created to study gain-of-function phenotypes and subcellular localization. To confirm the specificity of observed phenotypes, rescue experiments reintroducing wild-type srg-7 into null mutants should be performed. For temporal control of srg-7 expression, researchers can employ heat-shock promoters or degron-based systems. Tissue-specific expression using well-characterized promoters will help identify the cellular contexts where srg-7 functions. Phenotypic analysis should include standard C. elegans behavioral assays (chemotaxis, thermotaxis, locomotion) as well as more specialized tests based on hypothesized srg-7 functions. Calcium imaging using GCaMP in identified neurons expressing srg-7 can provide direct evidence of neuronal activation in response to potential ligands. Finally, comprehensive transcriptomic and proteomic analyses comparing wild-type and srg-7 mutants under various conditions can reveal downstream molecular pathways affected by srg-7 signaling, providing insights into its physiological role.

What are the key considerations for designing experiments to investigate potential interactions between srg-7 and other membrane proteins?

Investigating potential interactions between srg-7 and other membrane proteins requires careful experimental design that accounts for the complexities of membrane protein biology. Researchers should first identify candidate interaction partners through bioinformatic analyses of co-expression patterns and protein-protein interaction predictions. For physical interaction studies, co-immunoprecipitation using differentially tagged proteins (e.g., srg-7 with DYKDDDDK tag and potential partners with HA or V5 tags) should be performed under conditions that preserve membrane protein complexes, using appropriate detergents like digitonin or CHAPS. Proximity-based approaches such as BRET or bimolecular fluorescence complementation (BiFC) provide powerful tools for detecting interactions in living cells without disrupting membrane environments. Based on research with PfSR12, which acts as a chaperone increasing the surface expression of other GPCRs , researchers should perform surface ELISA experiments to quantify changes in membrane expression when srg-7 is co-expressed with potential partners. Functional interaction studies measuring changes in signaling properties (calcium mobilization, DAG formation, PKC activation) when srg-7 is co-expressed with other receptors can reveal functional consequences of interactions . Finally, advanced super-resolution microscopy techniques can visualize co-localization at the nanoscale level, while fluorescence recovery after photobleaching (FRAP) experiments can assess whether co-expression affects lateral mobility of membrane proteins. This multi-faceted approach will provide comprehensive insights into the potential role of srg-7 in protein-protein interactions at the membrane level.

How should researchers analyze complex signaling data from srg-7 functional studies?

Analyzing complex signaling data from srg-7 functional studies requires sophisticated approaches that account for the multidimensional nature of GPCR signaling networks. Researchers should employ time-course analysis of multiple signaling pathways simultaneously (calcium, DAG, PKC) to create kinetic profiles that can distinguish direct versus indirect signaling events . For concentration-response data, researchers should fit curves using appropriate mathematical models (four-parameter logistic function) to extract pharmacological parameters including EC50 values, maximum responses, and potential signaling bias across different pathways. Normalization strategies are critical to account for variations in receptor expression levels across experiments; surface ELISA data should be used to normalize functional responses to receptor expression . For detecting signaling bias, researchers should calculate transduction coefficients (log(τ/KA)) for each pathway and compare these values statistically. When analyzing data from G protein knockout and rescue experiments, as demonstrated with Gq/11 knockout cells , mixed-effects models should be used to account for both fixed effects (receptor type, G protein expression) and random effects (experimental variation). For high-dimensional datasets from proteomic or phosphoproteomic studies of srg-7 signaling, dimensionality reduction techniques (PCA, t-SNE) followed by pathway enrichment analysis can identify key nodes in the signaling network. Finally, researchers should implement systems biology approaches including computational modeling of signaling networks to predict and test potential feedback mechanisms and pathway crosstalk that may influence srg-7 signaling dynamics.

What statistical approaches are most appropriate for analyzing srg-7 expression data across different tissues or developmental stages?

For analyzing srg-7 expression data across different tissues or developmental stages, researchers should implement robust statistical approaches that account for biological variability and technical factors. When comparing srg-7 expression across multiple tissues or time points using qPCR or RNA-seq data, researchers should employ mixed-effects models that incorporate both fixed effects (tissue type, developmental stage) and random effects (biological replicates). For RNA-seq analysis, differential expression tools such as DESeq2 or edgeR that model count data using negative binomial distributions are most appropriate, with appropriate correction for multiple testing (Benjamini-Hochberg procedure). Analyzing the correlation between srg-7 expression and potential interaction partners requires calculation of Pearson or Spearman correlation coefficients across samples, followed by permutation tests to establish significance thresholds. For spatial expression data from in situ hybridization or immunohistochemistry, quantitative image analysis should be performed using specialized software that can segment tissues and cells, followed by non-parametric statistical tests to compare expression levels across regions. Time-series expression data should be analyzed using functional data analysis approaches that can identify significant temporal patterns. Finally, researchers should consider employing Bayesian hierarchical models when integrating multiple data types (transcript levels, protein abundance, cellular localization) to provide a comprehensive view of srg-7 expression dynamics while appropriately modeling uncertainty at each level of analysis.

What are the implications of srg-7 research for understanding human GPCR biology?

The study of srg-7 in C. elegans has significant implications for understanding human GPCR biology due to evolutionary conservation of fundamental signaling mechanisms. Although srg-7 itself may not have a direct human ortholog, research on serpentine receptors provides insights into conserved structural features and signaling pathways of GPCRs across species. Studies of serpentine receptors like PfSR12 have revealed mechanisms including chaperone-like functions that increase the expression of other GPCRs , which may be relevant to understanding GPCR trafficking and regulation in human cells. The G protein coupling specificity and downstream signaling pathways observed in serpentine receptors, such as the Gq/11-dependent calcium mobilization, DAG formation, and PKC activation demonstrated for PfSR12 , represent conserved mechanisms that apply across species. The methodological approaches developed for studying srg-7, including BRET-based biosensors for detecting various second messengers , can be directly applied to human GPCR research. Additionally, the simplified nervous system of C. elegans provides a valuable model for understanding how GPCRs contribute to neural circuit function and behavior, with potential insights into human neurological and psychiatric disorders involving GPCR dysfunction. By elucidating fundamental principles of GPCR biology in model organisms like C. elegans, srg-7 research contributes to a broader understanding of this important receptor family across species.

How can the methodologies developed for srg-7 research be applied to other orphan GPCRs?

The methodologies developed for srg-7 research provide a valuable framework that can be applied to deorphanize and characterize other GPCRs with unknown ligands or functions. The expression systems optimization strategies used for srg-7, including selection of appropriate vectors like pcDNA3.1+/C-(K)DYK with detection tags , can be directly applied to other orphan GPCRs. The suite of BRET-based biosensors employed in serpentine receptor research for detecting calcium mobilization, DAG formation, and PKC activation constitutes a powerful toolbox for screening potential ligands across multiple signaling pathways simultaneously. The experimental design incorporating G protein specificity controls, including the use of G protein knockout cell lines with selective inhibitors like YM-254890 , provides a rigorous approach for delineating signaling pathways of orphan GPCRs. Surface expression quantification methods using ELISA can reveal potential chaperone effects or expression regulation mechanisms that may be common across orphan GPCRs. The bioinformatic approaches used to predict structural features and potential ligand-binding domains of srg-7 can be adapted for other orphan receptors based on sequence homology and structural modeling. Finally, the in vivo approaches developed in C. elegans for srg-7 functional characterization provide a blueprint for creating animal models to study the physiological roles of orphan GPCRs in their native context. This comprehensive methodological framework accelerates the process of orphan GPCR characterization, potentially leading to the identification of novel therapeutic targets.

What are the major outstanding questions in srg-7 research?

Despite advances in understanding serpentine receptors, several critical questions about srg-7 remain unanswered. Foremost is the identification of its endogenous ligand(s), which is essential for understanding its physiological function. The precise signaling pathways activated by srg-7 and whether it exhibits signaling bias toward specific G protein subtypes remain to be fully characterized. The potential role of srg-7 as a chaperone for other membrane proteins, similar to what has been observed with PfSR12 , represents an intriguing possibility that requires further investigation. The expression pattern and subcellular localization of srg-7 across different tissues and developmental stages in C. elegans needs comprehensive mapping to understand its spatial and temporal regulation. The functional consequences of potential post-translational modifications on srg-7 activity and trafficking remain unexplored. The evolutionary relationships between srg-7 and other serpentine receptors across species could provide insights into conserved functions. The potential formation of homodimers or heterodimers with other GPCRs and how such interactions might alter signaling properties represents another important area for investigation. Finally, the physiological consequences of srg-7 dysfunction in C. elegans and whether it contributes to specific behavioral or developmental phenotypes remain to be fully elucidated. Addressing these outstanding questions will provide a more comprehensive understanding of srg-7 biology and its significance in C. elegans physiology.

What emerging technologies might advance our understanding of srg-7 function?

Emerging technologies across multiple disciplines hold promise for transforming our understanding of srg-7 function. Cryo-electron microscopy advances may soon enable structural determination of membrane proteins like srg-7 in near-native conditions, providing unprecedented insights into ligand binding sites and conformational changes. Single-cell transcriptomics and proteomics applied to C. elegans can reveal cell-specific expression patterns and signaling responses following srg-7 activation. CRISPR-based technologies beyond gene knockout, such as base editing and prime editing, will enable precise modification of key residues to test structure-function hypotheses without complete protein disruption. Optogenetic and chemogenetic approaches adapted for GPCRs could allow temporal control of srg-7 activation in specific cells to dissect its acute signaling effects. Advanced imaging technologies including lattice light-sheet microscopy and expansion microscopy can provide nanoscale visualization of srg-7 localization and trafficking dynamics in living C. elegans. Microfluidic devices coupled with automated behavioral analysis can enable high-throughput screening of potential srg-7 ligands based on C. elegans behavioral responses. Computational approaches including advanced molecular dynamics simulations and machine learning algorithms for predicting protein-ligand interactions will accelerate ligand discovery. Finally, multi-omics data integration approaches will enable systems-level understanding of how srg-7 signaling networks interact with other cellular pathways. These technological advances, applied in combination, promise to resolve many outstanding questions about srg-7 biology and potentially reveal unexpected functions beyond traditional GPCR signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.