Recombinant Serpentine receptor class gamma-9 (srg-9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your needs.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag type, please inform us; we will prioritize its development.
Synonyms
srg-9; T12A2.10; Serpentine receptor class gamma-9; Protein srg-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-9
Target Protein Sequence
MDTNSTTPMSITDMECNPNYSYLVENIKYLLQAAYMVPPAFLYARILYVIWVKHRKVYSR HQFFVIYSMDSIVGFILLLLDIFITRFFVYVPQLCIPASKFFQSHSLLMNIYYPLLNYLH CAQPLIQIFLTLNRMSSVIWPVDHNKVWSKNLSFIVAFVSLSPFLIIWNTIISPKIIIYY FGGFFMLGLKAVEWADISLFLFLVRSVAVIITVASTVIMFLRMSKMKKRMKSSERTLCLA CVIHSICFMVPSFFEALANFNEAYGSSWVNFLIQPFAWDVLNVGSPLIMIFVSGQLRHHV LEISIGCCKPKNKPKTITVHTVTAHVSSRNGTSIFR
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T12A2.10

UniGene: Cel.24373

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class gamma-9 (srg-9) and where is it expressed?

Serpentine receptor class gamma-9 (srg-9) is a G-protein coupled receptor (GPCR) found in the nematode Caenorhabditis elegans. It belongs to the larger superfamily of seven-transmembrane domain receptors that signal through heterotrimeric G-proteins. GPCRs constitute the largest group of cell-surface proteins in the human genome and function as receptors for a wide range of stimuli . In C. elegans specifically, serpentine receptors like srg-9 are part of the chemosensory system that allows the worm to detect and respond to environmental cues. Expression is primarily found in sensory neurons, though specific expression patterns for srg-9 may vary depending on developmental stage and environmental conditions.

How does srg-9 compare structurally to other serpentine receptors?

Structurally, srg-9 shares the characteristic seven-transmembrane domain architecture common to all GPCRs. Like other serpentine receptors, it contains an extracellular N-terminus, seven membrane-spanning alpha-helices connected by alternating intracellular and extracellular loops, and an intracellular C-terminus that interacts with G-proteins. The sequence and structural homology between srg-9 and other serpentine receptors can provide insights into its function and ligand binding properties. Based on the classification system for GPCRs, serpentine receptors in C. elegans would fall under the rhodopsin family (Class-A), which is the largest of the four main GPCR families .

What expression systems are most effective for producing recombinant srg-9?

Recombinant production of membrane proteins like srg-9 presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on current approaches for similar proteins, several expression systems can be considered:

  • Cell-free protein synthesis (CFPS): This approach offers advantages for membrane proteins like srg-9. Using an Escherichia coli-based CFPS system can yield high amounts of protein (up to 2 mg/mL as demonstrated with other GPCRs) and allows for incorporation of necessary components for proper folding .

  • E. coli-based cellular expression: Traditional bacterial expression systems can be used but often require optimization of codon usage, fusion partners, and solubilization strategies.

  • Eukaryotic expression systems: Yeast, insect, or mammalian cell systems may provide better folding environments for complex membrane proteins like serpentine receptors.

The choice of system should be guided by the specific experimental requirements, with CFPS offering advantages for initial structural characterization and E. coli or eukaryotic systems potentially providing better functionality.

What are the critical factors for obtaining properly folded recombinant srg-9?

Obtaining properly folded recombinant srg-9 requires careful attention to several factors:

  • Membrane mimetics: Proper folding of membrane proteins requires suitable membrane-like environments. Options include detergents, nanodiscs, liposomes, or amphipols.

  • Stabilization strategies: Thermostabilizing mutations may improve expression and stability, similar to approaches used for other GPCRs. Research has shown that creating thermostable variants (as demonstrated with neurotensin receptor 1) can improve yields and structural integrity .

  • Post-translational modifications: If srg-9 requires glycosylation or other modifications, eukaryotic expression systems may be necessary.

  • Quality control: Proper folding should be verified through secondary structure analysis (circular dichroism) and functional binding assays. As observed with other GPCRs, cell-free produced proteins may attain correct secondary structure but not necessarily proper tertiary structure .

  • Buffer optimization: Screening different buffer conditions can significantly impact folding efficiency and stability.

How should experiments be designed to study srg-9 function in vivo?

When designing experiments to study srg-9 function in vivo, researchers should consider the following approaches:

  • Genetic manipulation: CRISPR/Cas9-mediated gene editing or RNAi knockdown can be used to alter srg-9 expression. The resulting phenotypes can provide insights into its physiological role.

  • Randomized experimental design: For rigorous statistical analysis, implement proper randomization in experimental design as outlined in statistical design principles. This helps minimize bias and experimental error .

  • Appropriate controls: Include positive and negative controls to validate experimental outcomes. Wild-type C. elegans should be compared with srg-9 mutants under identical conditions.

  • Replication: Ensure sufficient biological and technical replicates to obtain statistically significant results. As noted in experimental design principles, replication is essential for estimating experimental error .

  • Environmental variables: Control for temperature, food availability, population density, and other factors that might influence C. elegans physiology and behavior.

The table below outlines a basic experimental design approach for studying srg-9 function:

Experimental GroupGenotypeTreatmentMeasurementsReplicates
ControlWild-typeStandard conditionsBehavioral assays, Size measurementsn ≥ 30
Test 1srg-9 knockoutStandard conditionsBehavioral assays, Size measurementsn ≥ 30
Test 2srg-9 overexpressionStandard conditionsBehavioral assays, Size measurementsn ≥ 30
Test 3Wild-typeLigand exposureBehavioral assays, Size measurementsn ≥ 30
Test 4srg-9 knockoutLigand exposureBehavioral assays, Size measurementsn ≥ 30

What experimental controls are essential when working with recombinant srg-9?

When working with recombinant srg-9, several controls are essential to ensure experimental validity:

  • Expression controls: Include both positive controls (well-expressed membrane proteins) and negative controls (empty vector) to validate expression systems.

  • Folding controls: Use circular dichroism (CD) or other spectroscopic methods to confirm proper secondary structure formation, as demonstrated with other recombinant GPCRs .

  • Functional controls: Compare recombinant srg-9 produced in different systems (e.g., cell-free vs. cellular) to ensure functional equivalence. Research has shown that cell-free produced GPCRs may have disrupted tertiary structure despite correct secondary structure .

  • Ligand binding controls: Include known GPCR ligands and receptors to validate binding assays.

  • Specificity controls: Test related but distinct serpentine receptors to confirm specificity of any observed effects.

These controls help distinguish genuine biological phenomena from artifacts of the experimental system.

How can researchers effectively analyze the interaction between srg-9 and potential ligands?

To analyze interactions between srg-9 and potential ligands, researchers should consider multiple complementary approaches:

  • Binding assays: Radioligand binding, fluorescence-based assays, or surface plasmon resonance can measure direct ligand binding. These methods should include competitive and non-competitive binding analyses to determine binding modes .

  • Functional assays: Measure downstream signaling events such as calcium mobilization, cAMP production, or G-protein activation to confirm functional coupling.

  • Structural studies: NMR spectroscopy (e.g., 1H-13C HMQC SOFAST) can provide insights into structural changes upon ligand binding, though this requires 13C-labeling of specific residues .

  • In silico modeling: Computational approaches can predict binding sites and interaction energies.

  • Statistical analysis: Apply appropriate statistical tests to binding data, following principles of experimental design analysis .

When analyzing binding data, researchers should be aware of the potential for non-specific binding and ensure proper controls are in place.

What are the best approaches for structural characterization of recombinant srg-9?

Structural characterization of recombinant srg-9 can be approached through several complementary techniques:

  • X-ray crystallography: While challenging for membrane proteins, this remains the gold standard for high-resolution structural determination.

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structure determination without the need for crystallization.

  • Nuclear Magnetic Resonance (NMR): Particularly useful for studying dynamics and ligand interactions. HMQC SOFAST NMR can be used with isotopically labeled proteins to assess tertiary structure, as demonstrated with other GPCRs .

  • Circular Dichroism (CD): Provides information about secondary structure content and can confirm proper folding.

  • Computational modeling: Homology modeling based on related receptors with known structures can provide initial structural insights.

Each method has strengths and limitations, and combining multiple approaches typically yields the most comprehensive structural information.

How can researchers resolve contradictory data when characterizing srg-9?

When faced with contradictory data during srg-9 characterization, researchers should follow these systematic approaches:

  • Validation across methods: Confirm observations using multiple independent techniques. For instance, if binding data from cell-free and cellular expression systems differ (as observed with other GPCRs ), investigate using alternative binding assays.

  • Control for experimental variables: Systematically examine buffer conditions, temperature, protein concentration, and other variables that might explain discrepancies.

  • Expression system comparison: As demonstrated with other GPCRs, proteins produced in different systems (e.g., cell-free vs. cellular) may have structural differences despite similar secondary structure profiles .

  • Statistical analysis: Apply robust statistical methods to determine if apparent contradictions are statistically significant or within expected variation .

  • Literature review: Compare with similar receptors to identify if the contradictions reflect known biological complexity.

Documenting all experimental conditions meticulously is essential for troubleshooting contradictory results.

What statistical approaches are most appropriate for analyzing srg-9 experimental data?

The appropriate statistical approaches for srg-9 experimental data depend on the specific experimental design and data characteristics:

  • For comparing multiple experimental groups (e.g., different mutants or conditions):

    • Analysis of Variance (ANOVA): When comparing means across multiple groups

    • Randomized Block Design: When controlling for known sources of variation

  • For binding studies:

    • Non-linear regression for dose-response curves

    • Scatchard or Hill plots for analyzing binding kinetics

  • For structural data:

    • Cluster analysis for conformational states

    • Principal Component Analysis (PCA) for identifying major structural variations

  • For experimental design:

    • Follow principles of proper randomization and replication to minimize bias

    • Use power analysis to determine appropriate sample sizes

  • For data presentation:

    • Use appropriate graphs based on data type (line graphs for trends over time, bar graphs for comparisons between discrete groups)

    • Include proper statistical notation in tables and figures

The table below summarizes statistical approaches for different types of srg-9 experiments:

Experiment TypeRecommended Statistical ApproachVisualization Method
Ligand bindingNon-linear regression, Scatchard analysisScatter plots with regression lines
Mutant phenotypesANOVA with post-hoc testsBar graphs with error bars
Expression levelst-tests or ANOVABox plots or bar graphs
Structural comparisonsCluster analysis, RMSD calculationsHeat maps, structural overlays
Time-course experimentsRepeated measures ANOVALine graphs

What are the established methods to determine the signaling pathways associated with srg-9?

To determine signaling pathways associated with srg-9, researchers can employ several complementary approaches:

  • G-protein coupling assays: Measure activation of different G-protein subtypes (Gαs, Gαi, Gαq, Gα12/13) using GTPγS binding, BRET, or FRET-based assays.

  • Second messenger assays: Quantify downstream second messengers such as cAMP, calcium, or inositol phosphates following receptor activation.

  • Reporter gene assays: Utilize transcriptional reporters driven by pathway-specific response elements to monitor signaling outputs.

  • Genetic approaches: Analyze phenotypes in C. elegans strains with mutations in specific G-proteins or downstream effectors to identify epistatic relationships with srg-9.

  • Phosphoproteomic analysis: Identify proteins phosphorylated following receptor activation to map signaling networks.

As with other GPCRs, serpentine receptors typically couple to multiple G-proteins with varying efficacies, and comprehensive characterization requires examining multiple pathways .

How can researchers identify the natural ligands for srg-9?

Identifying natural ligands for orphan receptors like srg-9 presents significant challenges but can be approached through several strategies:

  • Reverse pharmacology:

    • Screen libraries of natural compounds found in C. elegans habitat

    • Test fractionated C. elegans extracts for activation of recombinant srg-9

    • Monitor receptor internalization or conformational changes upon exposure to candidate molecules

  • Bioinformatic approaches:

    • Phylogenetic analysis to identify related receptors with known ligands

    • Structural modeling to predict binding pocket characteristics

    • Gene co-expression analysis to identify potential ligand-producing cells

  • Behavioral assays:

    • Compare wild-type and srg-9 mutant responses to chemical stimuli

    • Identify conditions where srg-9 expression is upregulated

  • Chemical biology:

    • Photoaffinity labeling with promiscuous ligands

    • Activity-based protein profiling

The combination of these approaches increases the likelihood of identifying physiologically relevant ligands.

What methodologies can effectively measure changes in srg-9 expression under different conditions?

To effectively measure changes in srg-9 expression under different conditions, researchers can employ several complementary techniques:

  • Quantitative PCR (qPCR): Allows precise quantification of srg-9 mRNA levels relative to housekeeping genes.

  • RNA sequencing (RNA-seq): Provides comprehensive transcriptome analysis, enabling detection of srg-9 expression changes in the context of global gene expression patterns. This approach has been successfully used for studying gene expression changes in C. elegans .

  • Reporter gene constructs: GFP or other fluorescent proteins fused to the srg-9 promoter enable visualization of expression patterns in living animals.

  • Western blotting: Quantifies protein levels using specific antibodies against srg-9 or epitope tags on recombinant versions.

  • Mass spectrometry: Allows absolute quantification of protein abundance using labeled reference peptides.

The table below outlines the advantages and limitations of each method:

MethodResolutionSensitivityThroughputLimitations
qPCRSingle geneHighMediummRNA may not reflect protein levels
RNA-seqGenome-wideHighHighCostly, requires bioinformatic expertise
Reporter constructsCellularMediumLowMay not reflect endogenous regulation
Western blottingProtein-specificMediumLowRequires specific antibodies
Mass spectrometryProteome-wideMedium-HighMediumComplex sample preparation

What are the best practices for presenting srg-9 experimental data in scientific publications?

When presenting srg-9 experimental data in scientific publications, researchers should follow these best practices:

  • For sequence and structural data:

    • Present sequence alignments with related receptors to highlight conserved domains

    • Use standardized representations for membrane protein topology

    • Include high-quality molecular graphics for structural models

  • For functional data:

    • Present dose-response curves with appropriate statistical measures

    • Use consistent formatting elements (uniform font/frame/box) for all tables

    • Include definitions for all abbreviations in table legends or footnotes

  • For expression data:

    • Use appropriate graph types based on data characteristics:

      • Line graphs for time-course experiments

      • Bar graphs for comparing discrete groups

      • Scatter plots for showing distribution of individual data points

  • For statistical analysis:

    • Clearly indicate sample sizes and statistical tests used

    • Include appropriate error bars (standard deviation, standard error, or confidence intervals)

    • Report exact p-values rather than significance thresholds

  • Tables and figures should be self-explanatory and not duplicate information presented in the text . They should summarize or emphasize important or unexpected findings.

How should researchers analyze and present contradictory findings related to srg-9 function?

When analyzing and presenting contradictory findings related to srg-9 function, researchers should:

  • Present all data transparently:

    • Show both supporting and contradicting evidence

    • Avoid selective reporting of favorable results

    • Use clear visual representations that highlight discrepancies

  • Analyze methodological differences:

    • Create comparative tables showing different experimental conditions

    • Systematically evaluate how methodological variations might explain contradictions

    • Consider expression system differences, as seen with other GPCRs where cell-free and cellular expression yielded proteins with different properties

  • Statistical considerations:

    • Apply appropriate statistical tests to determine if contradictions are statistically significant

    • Consider power analysis to ensure adequate sample sizes

    • Use multiple testing corrections when comparing across many conditions

  • Contextualize within existing literature:

    • Discuss how contradictions relate to published findings

    • Consider biological complexity and regulation that might explain apparent contradictions

  • Propose testable hypotheses:

    • Present models that could reconcile contradictory findings

    • Suggest future experiments to resolve discrepancies

What standardized formats should be used for sharing srg-9 experimental data?

Standardized formats for sharing srg-9 experimental data ensure reproducibility and facilitate meta-analyses:

  • Sequence data:

    • Deposit nucleotide and protein sequences in GenBank, UniProt, or similar databases

    • Follow INSDC (International Nucleotide Sequence Database Collaboration) guidelines

  • Structural data:

    • Submit 3D structures to the Protein Data Bank (PDB)

    • Follow mmCIF format guidelines for structural data

    • Include validation reports with structural submissions

  • Functional assay data:

    • Follow MIABE (Minimum Information About a Bioactive Entity) guidelines

    • Include raw data in supplementary materials using standardized formats (CSV, XML)

  • Expression data:

    • Submit RNA-seq data to Gene Expression Omnibus (GEO) or similar repositories

    • Follow MINSEQE (Minimum Information about a high-throughput Nucleotide SEQuencing Experiment) guidelines

  • Data visualization:

    • Use consistent elements (uniform font/frame/box) for all tables and figures

    • Provide definitions of each abbreviation in table legends

    • Format data tables with appropriate statistical measures

Sharing raw data alongside processed results enhances transparency and enables independent verification of findings.

How can advanced genomic techniques be applied to understand srg-9 function in C. elegans?

Advanced genomic techniques offer powerful approaches to understanding srg-9 function:

  • ChIP-seq analysis: Chromatin immunoprecipitation followed by sequencing can identify transcription factors that regulate srg-9 expression. Similar approaches have been successfully applied to study other signaling pathways in C. elegans .

  • CRISPR-Cas9 genome editing: Precise modification of the srg-9 gene can create:

    • Complete knockouts

    • Point mutations to test specific functional hypotheses

    • Tagged versions for localization studies

    • Conditional alleles for temporal control

  • Single-cell RNA sequencing: Characterize expression patterns with cellular resolution and identify co-expressed genes that may function in the same pathway.

  • Whole-genome sequencing of natural isolates: Identify natural variations in srg-9 across C. elegans populations to infer selective pressures and functional constraints.

  • Comparative genomics: Analyze srg-9 orthologs across nematode species to identify conserved domains and species-specific adaptations.

These approaches can reveal regulatory networks and evolutionary patterns that provide insights into srg-9 biological function.

What are the potential applications of studying srg-9 beyond basic C. elegans biology?

The study of srg-9 has potential applications beyond basic C. elegans biology:

  • Comparative GPCR biology: Insights from srg-9 structure and function can inform our understanding of GPCR signaling across species, including in humans where GPCRs constitute the largest group of cell-surface proteins and are targets for approximately 30-40% of all modern medicines .

  • Drug discovery platforms: C. elegans serpentine receptors can serve as models for developing high-throughput screening assays for GPCR modulators.

  • Evolutionary biology: Studying srg-9 can provide insights into the evolution of chemosensory systems across species.

  • Synthetic biology: Understanding the modular nature of GPCR signaling can inform the design of synthetic receptors with novel properties.

  • Agricultural applications: Nematode-specific GPCRs represent potential targets for developing selective anthelmintics with minimal off-target effects on non-target organisms.

The fundamental insights gained from studying serpentine receptors in model organisms contribute to our broader understanding of membrane protein biology and signal transduction.

What are the most significant unresolved questions regarding srg-9 function?

Despite advances in our understanding of serpentine receptors in C. elegans, several critical questions about srg-9 remain unresolved:

  • The identity of the natural ligand(s) for srg-9 remains unknown, limiting our understanding of its physiological role.

  • The precise signaling pathways and G-protein coupling preferences of srg-9 have not been fully characterized.

  • The three-dimensional structure of srg-9 has not been determined, hampering structure-based approaches to understanding its function.

  • The regulation of srg-9 expression during development and in response to environmental cues requires further investigation.

  • The evolutionary conservation and divergence of srg-9 function across nematode species remains to be fully explored.

These knowledge gaps represent opportunities for researchers to make significant contributions to our understanding of this receptor and GPCR biology more broadly.

How might future technological advances enhance our understanding of srg-9?

Future technological advances are likely to enhance our understanding of srg-9 in several ways:

  • Improved cryo-EM techniques will facilitate structural determination of membrane proteins like srg-9 without the need for crystallization.

  • Advanced computational methods, including machine learning approaches, will enhance prediction of protein structure, dynamics, and ligand interactions.

  • Development of more sensitive biosensors will enable real-time monitoring of receptor activation in living organisms.

  • Single-molecule techniques will provide insights into conformational changes and signaling dynamics at unprecedented resolution.

  • Expansion of genetic tools in C. elegans will enable more precise spatiotemporal control of gene expression and protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.