Recombinant Serpentine receptor class r-10 (odr-10)

Shipped with Ice Packs
In Stock

Description

Functional Insights

ODR-10 is essential for chemotaxis toward diacetyl, a volatile compound produced by microbial metabolism. Key functional properties include:

Ligand Specificity

LigandResponseSource
Diacetyl (2,3-butanedione)Strong agonist; elicits Ca²⁺ flux in mammalian cells
Pyruvate/CitrateWeak activation (metabolic precursors of diacetyl)
2,3-PentanedioneNo activation (methylated analog of diacetyl)

Interaction Partners

  • odr-4: Required for ODR-10 localization to cilia .

  • STR-112 & Rat I7 OR: Forms hetero-oligomers in yeast .

  • SSTR5 (Human): No interaction, highlighting receptor specificity .

Research Findings from Heterologous Systems

Recombinant ODR-10 has been expressed in yeast, mammalian cells, and E. coli to study its biophysical and signaling properties:

Expression SystemKey FindingMethodSource
Human HEK293 CellsDiacetyl induces transient Ca²⁺ elevation (EC₅₀ ≈ 1 µM) Calcium imaging
Yeast (S. cerevisiae)Homo-oligomerization confirmed via BRET and co-immunoprecipitation BRET², Co-IP
Yeast Two-Hybrid SystemHetero-oligomerizes with STR-112 and rat I7 odorant receptor Split-ubiquitin assay

Production Platforms

Recombinant ODR-10 is commercially available in multiple formats:

Host SystemTag/ConjugateApplicationProduct Code
YeastNativeInteraction studiesCSB-YP733759CXX1
E. coliAviTag-BiotinStructural analysisCSB-EP733759CXX1-B
BaculovirusNativeHigh-yield productionCSB-BP733759CXX1
Mammalian CellsNativeFunctional signaling assaysCSB-MP733759CXX1

Applications in Research

  1. Mechanistic Studies of Olfaction: ODR-10 serves as a model for understanding GPCR-mediated odorant detection .

  2. Ligand-Receptor Dynamics: Used to map residues critical for diacetyl binding via mutagenesis .

  3. Oligomerization Studies: Insights into GPCR heteromer formation and functional crosstalk .

  4. Evolutionary Comparisons: Sequence divergence analysis with mammalian odorant receptors .

Key Challenges and Future Directions

  • Functional Relevance of Oligomers: While ODR-10 forms heteromers in vitro, their in vivo significance remains unknown .

  • Ligand Discrimination: ODR-10’s ability to distinguish diacetyl from structurally similar compounds (e.g., pyrazine) involves auxiliary factors beyond the receptor itself .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped standard with blue ice packs. If dry ice shipping is preferred, please communicate with us beforehand as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend a brief centrifugation of the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
odr-10; CBG10912; Serpentine receptor class r-10; Odorant response abnormal protein 10; Olfactory receptor 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
odr-10
Target Protein Sequence
MTGELWLTLVDTADIVGFSMTFCVNIVLLFLLKNRGKNLGTYKHLMAFFSVFSIFYAIIE SILRPIMHIENATFFLISRKRFNYSTRLGKINSAFYCACFATSFVVSGVHFVYRFFASCK PHLLRSFNMPYLLLWPLGCSIPVMMWASVSYFLYPDTAFTEAAVTNVLNTHYHSIKKDNV SYIAYVYYQYDENGVRYVYLKNLLGCFVHYFVMSATFVVMFICGYLTWKTMRKHKTASDR TRQLQKQLFKALVLQTLIPTIFMYAPTGVMFIAPFFSINLNANANFIVFCSFLYPGLDPL ILILIIRDFRQTVFKFFCLRKKNSVDESRSTTRANMSQVATH
Uniprot No.

Target Background

Function
Odr-10 is an odorant receptor that influences chemotaxis towards the volatile odorant diacetyl. It plays a role in specifying AWA neuronal cell fate through the odr-7 pathway.
Database Links

STRING: 6238.CBG10912

Protein Families
Nematode receptor-like protein str family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is ODR-10 and what is its primary function in C. elegans?

ODR-10 is a seven-transmembrane domain olfactory receptor in C. elegans that belongs to the str family of G-Protein Coupled Receptors (GPCRs). It is predominantly expressed in the AWA neuron pair and mediates chemotaxis towards diacetyl, a volatile odorant. ODR-10 functions as the primary molecular detector for diacetyl, enabling C. elegans to sense and respond to this specific chemical cue in its environment . The receptor's high specificity for diacetyl over structurally similar compounds demonstrates remarkable molecular discrimination capabilities that contribute to the nematode's sophisticated chemosensory behavior system.

Where is ODR-10 expressed in C. elegans and how can this expression be visualized?

ODR-10 is primarily expressed in the AWA olfactory neurons of C. elegans. Researchers can visualize this expression pattern using reporter gene fusion techniques. The most effective approach involves using the ODR-10 promoter to drive expression of Green Fluorescent Protein (GFP), creating an ODR-10::GFP fusion gene in transgenic worms. This fusion gene shows strong expression specifically in the two AWA neurons, which are responsible for sensing low concentrations of diacetyl . When examined by fluorescence microscopy, the expression can be observed within the stereotypic branched AWA sensory cilia, which are exposed to the environment in specialized sensory organs at the anterior tip of the worm. More comprehensive analysis reveals that the protein product appears to localize to the sensory cilia of the AWA neurons, positioning the receptor at the interface between the animal and its environment where it can directly interact with chemical stimuli .

How does ODR-10 expression differ between male and hermaphrodite C. elegans?

ODR-10 expression exhibits notable sexual dimorphism in C. elegans, particularly in response to environmental conditions. While both sexes express ODR-10 in the AWA neurons, the regulatory mechanisms governing this expression differ significantly. In food deprivation conditions, both males and hermaphrodites show increased ODR-10 expression, but through different regulatory pathways . Hermaphrodites appear to rely primarily on internal signals of nutritional stress to modulate ODR-10 expression, while males integrate external food cues. This is evidenced by experiments with low-quality food sources (heat-killed E. coli), which significantly increased ODR-10 expression in hermaphrodites but not in males . These sex-specific differences in ODR-10 regulation likely reflect divergent selective pressures and behavioral strategies between the sexes in response to food availability.

Does ODR-10 form oligomeric structures, and how can these be experimentally detected?

ODR-10 has been demonstrated to form homo-oligomers, which was established using three complementary experimental approaches: co-immunoprecipitation, bioluminescence resonance energy transfer (BRET), and the split-ubiquitin yeast two-hybrid system . The most direct biochemical evidence comes from co-immunoprecipitation experiments where ODR-10-Rluc (Renilla luciferase-tagged ODR-10) co-expressed with ODR-10-GFP2 (GFP-tagged ODR-10) was successfully pulled down by anti-GFP antibody, resulting in significantly higher luciferase activity compared to control samples . These findings represent the first evidence that ODR-10 or any nematode GPCR can form homo-oligomers, suggesting that oligomerization may be an evolutionary conserved feature of GPCRs that extends to invertebrate chemosensory receptors.

What experimental approaches can be used to investigate potential hetero-oligomerization of ODR-10 with other chemosensory receptors?

Researchers investigating potential hetero-oligomerization of ODR-10 with other chemosensory receptors can employ several complementary techniques:

  • BRET Analysis: Bioluminescence resonance energy transfer can detect protein-protein interactions in living cells. By tagging ODR-10 with Renilla luciferase (Rluc) and potential partner receptors with GFP2, researchers can measure energy transfer as an indicator of close physical association .

  • Split-Ubiquitin Yeast Two-Hybrid System: This specialized variant of the yeast two-hybrid system is particularly suited for membrane proteins like GPCRs. It can identify direct interactions between ODR-10 and other chemosensory receptors in a cellular context.

  • Co-immunoprecipitation with Controls: When investigating hetero-oligomerization, it's critical to include appropriate negative controls. For example, co-expression of ODR-10-Rluc with SSTR5-GFP2 (somatostatin receptor 5) has been used as a negative control, typically showing approximately 20% of the total luminescence observed with true interaction partners .

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry analysis can identify interaction interfaces between ODR-10 and other receptors, providing structural insights into heteromeric complexes.

These approaches should be used in combination to provide robust evidence for or against hetero-oligomerization, as each method has its own strengths and limitations.

How is ODR-10 expression regulated genetically, and what role does ODR-7 play in this process?

ODR-10 expression is subject to sophisticated genetic regulation, with the transcription factor ODR-7 playing a central role in this regulatory network. Research has demonstrated that ODR-7 functions as a critical positive regulator of ODR-10 expression. This was established through both molecular and genetic approaches:

  • Transcriptional Analysis: When ODR-7 function is lost in odr-7(ky4) mutants, ODR-10 mRNA levels are significantly reduced or absent as determined by RT-PCR analysis .

  • Reporter Gene Studies: An integrated ODR-10::GFP fusion gene shows robust expression in wild-type animals but is dramatically reduced or absent in odr-7(ky4) mutant backgrounds .

  • Functional Consequences: The olfactory defects in odr-7 mutants partially overlap with those seen in odr-10 mutants, consistent with ODR-7's role in regulating ODR-10 expression.

This regulatory relationship appears to be direct, with ODR-7 likely binding to cis-regulatory elements in the ODR-10 promoter region to drive AWA-specific expression. The ODR-7-dependent regulation of ODR-10 provides an excellent model system for studying how cell-specific expression of chemosensory receptors is achieved in sensory neurons .

How does environmental food availability influence ODR-10 expression, and what methodologies can detect these changes?

Environmental food availability significantly modulates ODR-10 expression in C. elegans, with food deprivation leading to increased expression in both sexes, albeit through different regulatory mechanisms. Researchers can detect and quantify these changes using several complementary approaches:

  • Quantitative RT-PCR: This method reveals significant increases in ODR-10 mRNA levels upon food deprivation in both males and hermaphrodites, providing a direct measurement of transcriptional regulation .

  • Fluorescent Reporter Systems: ODR-10::GFP fusion constructs can visualize expression changes, though the specific reporter construct is crucial. The fosmid reporter fsEx295, which contains extended regulatory sequences compared to the kyIs53 reporter, provides greater sensitivity for detecting increased expression in hermaphrodites during food deprivation .

  • Experimental Food Manipulation: Various experimental approaches can be used to modulate food availability:

    • Complete food removal (creates metabolic stress)

    • Aztreonam-treated E. coli (creates inedible bacteria chains)

    • Heat-killed E. coli (low-quality food source)

    • Re-exposure experiments after food deprivation

These different food conditions produce distinct effects on ODR-10 expression patterns between males and hermaphrodites, highlighting the sex-specific integration of food cues and chemosensory receptor expression .

What are the most effective approaches for determining ODR-10 ligand specificity, and how selective is ODR-10 for diacetyl?

Determining ODR-10 ligand specificity requires a multi-faceted approach combining behavioral assays, genetic manipulation, and direct receptor analysis:

  • Chemotaxis Assays: The gold standard for assessing ODR-10 ligand specificity involves quantitative chemotaxis assays with wild-type and odr-10 mutant animals. These assays measure the animals' ability to navigate toward odorant sources. Wild-type C. elegans show strong chemotaxis toward diacetyl, while odr-10 null mutants exhibit severely impaired responses specifically to diacetyl but normal responses to other odorants .

  • Structure-Activity Relationship Analysis: Testing structurally similar compounds reveals that ODR-10 exhibits remarkable selectivity. For example, while ODR-10 is required for diacetyl (2,3-butanedione) chemotaxis, it is not essential for responses to the structurally similar 2,3-pentanedione, demonstrating high molecular discrimination capability .

  • Genetic Rescue Experiments: Expressing ODR-10 in odr-10 mutants under cell-specific promoters can confirm both receptor specificity and neuronal requirements. Rescue of diacetyl chemotaxis defects confirms the causal relationship between ODR-10 expression and diacetyl sensation.

  • Heterologous Expression Systems: Expressing ODR-10 in non-native cells (like yeast or mammalian cell lines) and measuring responses to candidate ligands using calcium imaging or other functional assays can directly assess receptor-ligand interactions in a controlled environment.

These approaches collectively demonstrate that ODR-10 is highly selective for diacetyl, with this specificity forming the molecular basis for C. elegans' ability to discriminate between structurally similar odorants .

How can researchers generate and validate loss-of-function ODR-10 mutants for functional studies?

Generating and validating loss-of-function ODR-10 mutants is critical for functional studies and can be accomplished through several complementary approaches:

  • Transposon-Mediated Mutagenesis: One effective strategy involves Tc1 transposon insertion followed by imprecise excision. This approach successfully generated the odr-10(ky225) deletion allele, which eliminates all coding sequences beyond the third transmembrane domain of the protein . This technique leverages natural transposon mobility in certain C. elegans strains.

  • CRISPR-Cas9 Genome Editing: More recently, targeted genome editing using CRISPR-Cas9 allows for precise deletion or modification of the ODR-10 locus. This approach can generate complete gene deletions or introduce specific mutations to interrogate structure-function relationships.

  • Validation Approaches:

    • Molecular Validation: PCR amplification and sequencing of the ODR-10 locus confirms the expected genetic changes

    • Transcriptional Analysis: RT-PCR or RNA-seq verifies the absence or alteration of ODR-10 transcripts

    • Behavioral Validation: Chemotaxis assays confirm specific defects in diacetyl sensation (while maintaining normal responses to other odorants sensed by AWA neurons, such as pyrazine)

    • Rescue Experiments: Reintroduction of wild-type ODR-10 should restore diacetyl chemotaxis, confirming specificity of the phenotype

The gold standard approach combines multiple validation methods to ensure that the observed phenotypes result specifically from loss of ODR-10 function rather than other genetic alterations or background effects .

How can ODR-10 be used as a model system for studying GPCR trafficking and localization in sensory neurons?

ODR-10 offers an excellent model system for studying GPCR trafficking and localization in sensory neurons due to its specific expression pattern and the powerful genetic tools available in C. elegans. Researchers can leverage this system through several methodological approaches:

  • Fluorescent Protein Tagging: ODR-10::GFP fusion proteins allow direct visualization of receptor localization to sensory cilia in living animals. Microscopy reveals that ODR-10 localizes specifically to the branched cilia of AWA neurons, the site of odorant detection . Time-lapse imaging can track receptor movement and turnover in real-time.

  • Genetic Manipulation of Trafficking Machinery: Researchers can systematically disrupt genes involved in intracellular trafficking (e.g., kinesin/dynein motors, IFT proteins, exocyst components) to identify factors required for proper ODR-10 localization. The effects can be quantified by measuring mislocalization patterns and corresponding functional deficits in chemotaxis.

  • Structure-Function Analysis: By introducing targeted mutations in potential trafficking motifs within the ODR-10 sequence and expressing these variants as fluorescent fusions, researchers can identify sequence elements required for proper ciliary localization. This approach has revealed critical determinants of GPCR transport and retention in sensory cilia.

  • Temporal Control Systems: Using heat-shock or drug-inducible promoters to control ODR-10 expression timing allows researchers to distinguish between defects in initial trafficking versus maintenance of localization or receptor turnover.

This model system is particularly valuable because the functional consequences of trafficking defects can be directly assessed through behavioral chemotaxis assays, providing an in vivo readout of receptor function that is rarely available in other GPCR research systems .

What insights about evolutionary conservation of chemosensory mechanisms can be gained through comparative studies of ODR-10 across nematode species?

Comparative studies of ODR-10 across nematode species provide valuable insights into the evolutionary conservation and diversification of chemosensory mechanisms:

  • Sequence Conservation Analysis: Bioinformatic comparison of ODR-10 homologs across nematode species (parasitic and free-living) reveals domains under purifying selection (conserved function) versus regions under diversifying selection (potentially adapting to different environmental niches). Transmembrane domains typically show higher conservation than extracellular loops involved in ligand binding.

  • Functional Conservation Testing: Heterologous expression experiments can determine whether ODR-10 homologs from different nematode species retain diacetyl sensitivity or have evolved to detect other ligands. This can be accomplished by expressing these homologs in odr-10 mutant C. elegans and assessing rescue of diacetyl chemotaxis.

  • Expression Pattern Comparison: Using promoter::reporter fusions from ODR-10 homologs across species can reveal conservation or divergence in neuronal expression patterns. This approach helps determine whether the sensory circuit architecture remains conserved even as receptor sequences evolve.

  • Ecological Correlation Studies: Correlating ODR-10 sequence variations with ecological niches of different nematode species (bacterial feeders, fungal feeders, parasites) provides insights into adaptive evolution of chemosensation. Species that inhabit environments where diacetyl detection provides fitness benefits likely maintain stronger functional conservation of ODR-10.

These comparative approaches illuminate how fundamental chemosensory mechanisms are maintained across evolutionary time while allowing for specialization to diverse ecological niches, providing a model for understanding sensory evolution more broadly .

What emerging technologies might advance our understanding of ODR-10 structure-function relationships?

Emerging technologies are poised to revolutionize our understanding of ODR-10 structure-function relationships, opening new avenues for research:

  • Cryo-Electron Microscopy: Recent advances in cryo-EM technology have enabled high-resolution structural determination of membrane proteins, including GPCRs. Applying this approach to purified ODR-10 could reveal its three-dimensional structure, particularly when complexed with diacetyl, illuminating the molecular basis of its ligand specificity .

  • Molecular Dynamics Simulations: As computational power increases, more sophisticated simulations of ODR-10 within lipid bilayers can model conformational changes during receptor activation, identifying key residues involved in ligand binding and signal transduction. These simulations can generate testable hypotheses about structure-function relationships.

  • Optogenetic Tools for Receptor Activation: Developing light-sensitive variants of ODR-10 would enable precise temporal control of receptor activation in vivo, allowing researchers to dissect downstream signaling events with unprecedented resolution. This approach could help delineate the functional consequences of receptor oligomerization.

  • Single-Molecule Tracking: Advanced super-resolution microscopy techniques can track individual ODR-10 molecules in living C. elegans sensory neurons, revealing dynamics of receptor movement, clustering, and interactions with other membrane components during odorant sensing and signal transduction.

  • CRISPR-Based Genetic Screens: Genome-wide CRISPR screens in C. elegans could identify novel factors involved in ODR-10 function, trafficking, and regulation. These unbiased approaches may uncover unexpected components of the olfactory signaling machinery.

These technologies, especially when used in complementary approaches, promise to transform our understanding of how this chemosensory receptor functions at the molecular level to mediate specific olfactory behaviors .

How might understanding of ODR-10 function contribute to broader applications in sensory biology and neuronal signaling?

Research on ODR-10 extends beyond basic science questions about this specific receptor and holds potential for broader applications in sensory biology and neuronal signaling:

  • Engineering Artificial Chemosensors: Understanding the molecular basis of ODR-10's specificity for diacetyl could inform the design of biosensors for detecting specific chemicals in environmental monitoring, food safety testing, or medical diagnostics. The receptor's high selectivity provides a valuable template for synthetic biology approaches to chemical detection .

  • Evolutionary Models of Sensory System Diversification: As one of the best-characterized chemosensory receptors in invertebrates, ODR-10 provides insights into how sensory systems evolve and diversify. Comparative studies across nematode species can illuminate principles of receptor evolution that may apply broadly across animal phyla .

  • Neural Circuit Development and Plasticity: The regulation of ODR-10 expression in response to food availability demonstrates how sensory systems adapt to changing environmental conditions. This model system can reveal mechanisms of neuronal plasticity that may be conserved in more complex nervous systems .

  • Drug Discovery Templates: The detailed understanding of ODR-10's structure-function relationships may provide templates for designing drugs targeting human GPCRs, which represent major pharmaceutical targets. Insights from this simpler system could inform approaches to modulating receptor activity or specificity .

  • Aging and Sensory Decline Models: C. elegans is an established model for studying aging. The well-characterized ODR-10 system provides an opportunity to investigate how sensory functions decline with age and identify interventions that might preserve chemosensory abilities over the lifespan.

These broader applications highlight how fundamental research on ODR-10 contributes to diverse fields beyond nematode biology, potentially informing approaches to human health, environmental monitoring, and synthetic biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.