Recombinant Serpentine receptor class T-55 (srt-55)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Serpentine receptors comprise a large family of membrane proteins characterized by their distinctive structure featuring seven transmembrane (7-TM) domains. These receptors are widely distributed across diverse organisms, including bacteria, fungi, plants, and all metazoans . The name "serpentine" derives from their snake-like configuration in the cell membrane, with segments weaving through the lipid bilayer seven times.

The classification of serpentine receptors varies across species. In mammals, they are often referred to as G protein-coupled receptors (GPCRs) due to their association with G proteins for signal transduction. For instance, GPR55 is a mammalian cannabinoid receptor that increases intracellular calcium through distinct signaling pathways . In contrast, the nematode C. elegans possesses numerous serpentine receptor classes, including the serpentine receptor class T, to which srt-55 belongs.

Evolutionary Conservation and Diversity

Serpentine receptors represent one of the most ancient and diversified protein families. Recent research has expanded our understanding of their presence in unexpected organisms. For example, a genome-wide search in the human malaria parasite Plasmodium falciparum identified four serpentine receptor-like proteins (PfSR1, PfSR10, PfSR12, and PfSR25) . These findings suggest that serpentine receptors may play essential roles even in protozoan parasites, potentially influencing host-cell interactions.

The conservation of these receptors across evolutionary distant species highlights their fundamental importance in cellular communication. While some serpentine receptors are highly conserved (like PfSR10 and PfSR25 among Plasmodium species), others show greater divergence (such as PfSR1 and PfSR12) . This pattern of conservation and divergence likely reflects both the essential core functions and the species-specific adaptations of these receptors.

Recombinant Protein Expression

Recombinant srt-55 protein is produced for research applications through molecular cloning and expression technologies. According to commercial product listings, the recombinant protein is available in quantities such as 50 μg, with other quantities also available for specific research needs .

Research Applications

Recombinant srt-55 has potential applications in various research contexts, particularly in studies focusing on:

  1. Receptor-ligand interaction studies

  2. Antibody development and validation

  3. Structural analysis of serpentine receptors

  4. Comparative studies of signal transduction mechanisms

  5. Functional genomics in C. elegans

The commercial availability of recombinant srt-55 facilitates research in these areas, providing standardized reagents for reproducible experiments. ELISA-based applications appear to be a common use for recombinant srt-55, as suggested by product listings .

Serpentine Receptors Across Species

While srt-55 is specific to C. elegans, serpentine receptors are found across diverse species with varying degrees of structural and functional conservation. The study of serpentine receptors in different organisms provides valuable insights into their evolutionary history and functional diversity.

In the malaria parasite Plasmodium falciparum, researchers identified four serpentine receptor-like proteins (PfSR1, PfSR10, PfSR12, and PfSR25) through genome-wide searches for proteins containing seven transmembrane domains . Expression of their corresponding genes was detected in the intraerythrocytic stages of P. falciparum, suggesting they encode functional proteins .

Interestingly, these malarial serpentine receptors display different expression patterns during the parasite's life cycle. PfSR1 and PfSR12 are predominantly expressed in the later stages of the intraerythrocytic cycle (from late trophozoite to schizont stages), while PfSR10 and PfSR25 are constitutively expressed throughout the cycle . This differential expression pattern suggests stage-specific roles for these receptors.

Signaling Mechanisms

Serpentine receptors employ diverse signaling mechanisms. For example, GPR55, a mammalian cannabinoid receptor, increases intracellular calcium through signaling pathways distinct from those used by CB1 and CB2 cannabinoid receptors . When stimulated by cannabinoid compounds like THC, JWH015, or anandamide, GPR55 triggers calcium release in cells .

The signaling pathway of GPR55 involves G12, RhoA, and the actin cytoskeleton . This was demonstrated through experiments using dominant-negative RhoA mutants, which suppressed GPR55-mediated calcium transients by 77-90% . In contrast to other cannabinoid receptors, GPR55 does not robustly activate the ERK1/2 kinase pathway .

While the specific signaling mechanisms of srt-55 have not been detailed in the available literature, comparative studies with better-characterized serpentine receptors might help predict its potential signaling pathways.

Experimental Techniques for Serpentine Receptor Research

Research on serpentine receptors employs various experimental techniques to characterize their structure, function, and signaling mechanisms. For instance, topology prediction programs are crucial for identifying potential transmembrane domains in these receptors. In studies of Plasmodium serpentine receptors, researchers used multiple prediction programs to increase confidence in the identification of seven transmembrane domains .

Real-time PCR has been effectively used to quantify the expression of serpentine receptors across different developmental stages . This technique could be applied to study srt-55 expression patterns in C. elegans under various conditions or developmental stages.

Functional studies often employ calcium imaging to detect receptor activation, as demonstrated in research on GPR55 . Similar approaches could be adapted to investigate srt-55 function, particularly if potential ligands can be identified.

Future Research Directions

Several promising research directions could advance our understanding of srt-55:

  1. Identification of natural ligands for srt-55

  2. Characterization of downstream signaling pathways

  3. Investigation of the receptor's role in C. elegans physiology

  4. Comparative studies with serpentine receptors in other nematodes

  5. Structural studies using advanced techniques like cryo-electron microscopy

Such research would not only enhance our understanding of srt-55 specifically but could also contribute to broader knowledge about serpentine receptor biology and evolution.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
srt-55; T16H12.8; Serpentine receptor class T-55; Protein srt-55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-363
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
srt-55
Target Protein Sequence
ICFDLKTLQCWPMEIQEMALMLTARNTARYDCSGKSKSEWYETGQKRLGWGIYYISSGLF FQLIGWPVIWVFITKFSMTNALKVYRIMVFIGLIEITEIWGNSVFPGFVAVFGEVYCTSP ILMTIVGKMTMVQWVLGSSSAAFLGFHRLCDMIQKLEWLVNTNTKTGLWLTVLFFYACYG SIFFDTVLFNSDYMAPLLDPMIGKQGIIYSNNFLYFHNIIVATTLILVYACLCTLWSSRE MNTSSLHVSKFQRSILLQSICISLTYAIPAISFVTMFVLPIPKWFFHVSDITYQLSGGLP FIMYICLNKRVREEFLHLLRVCRKAEKSQVAVIPLGNSTVSAFNN
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T16H12.8

UniGene: Cel.27720

Protein Families
Nematode receptor-like protein srt family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine Receptor Class T-55 (srt-55) and what is its functional significance?

Serpentine receptor class T-55 (srt-55) is a G-protein coupled receptor (GPCR) encoded by the srt-55 gene in Caenorhabditis elegans, with its full amino acid sequence characterized as shown in search result data from the product listing. The protein contains distinctive structural elements typical of serpentine receptors, including multiple transmembrane domains that create a characteristic folding pattern within the cell membrane of nematode cells. The amino acid sequence (ICFDLKTLQCWPMEIQEMALM... and continuing as documented) reveals conserved motifs essential for transmembrane localization and signal transduction capabilities . Functional studies suggest this receptor plays roles in chemosensation and neuronal signaling pathways, potentially responding to environmental or internal chemical cues that regulate C. elegans behavior and development. Studies of serpentine receptors in C. elegans often serve as model systems for understanding fundamental principles of GPCR function that may be applicable across species due to evolutionary conservation of key structural and functional domains.

What expression systems are recommended for producing recombinant srt-55?

Successful expression of functional recombinant srt-55 requires careful consideration of expression systems that can accommodate the complex membrane protein structure with proper folding and post-translational modifications. Bacterial expression systems (particularly E. coli) using specialized strains like Rosetta 2(DE3) or C41(DE3) are often employed for initial attempts due to their relative simplicity and cost-effectiveness, but typically yield lower functionality for membrane proteins like serpentine receptors. Insect cell expression systems using baculovirus vectors (particularly Sf9 or High Five cells) provide superior membrane protein expression with proper folding capabilities and can be optimized using secretion signal sequences to direct trafficking of srt-55 to cellular membranes. Mammalian expression systems (particularly HEK293 or CHO cells) represent the gold standard for producing highly functional srt-55, especially when intended for downstream functional assays, since they provide the most native-like environment for proper protein folding, glycosylation, and other post-translational modifications. Yeast systems like Pichia pastoris offer a compromise solution with higher protein yields than mammalian cells while still providing eukaryotic processing capabilities necessary for many aspects of srt-55 functionality.

What storage and handling protocols ensure optimal stability of recombinant srt-55?

Optimal storage of recombinant srt-55 requires careful attention to buffer composition and temperature conditions to maintain protein integrity and functionality. According to the product information, recombinant srt-55 should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage, with extension to -80°C recommended for long-term preservation to minimize protein degradation and maintain activity . Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity through structural disruption of the complex transmembrane domains characteristic of serpentine receptors. Working aliquots should be prepared during initial sample processing and stored at 4°C for up to one week to minimize degradation while maintaining ready accessibility for ongoing experiments . For membrane proteins like srt-55, consideration of detergent concentration in storage buffers is critical—too little detergent may lead to protein aggregation while excessive detergent can disrupt natural protein conformations. Addition of protease inhibitor cocktails in storage buffers is highly recommended to prevent degradation by contaminating proteases that can significantly reduce shelf-life of purified protein preparations even at lower temperatures.

How can researchers verify the identity and purity of recombinant srt-55 preparations?

Comprehensive verification of recombinant srt-55 identity and purity requires implementation of multiple complementary analytical techniques. SDS-PAGE analysis represents a fundamental first step, with expected molecular weight comparison against theoretical predictions based on the 363 amino acid sequence, though migration patterns may deviate from predictions due to the hydrophobic nature of transmembrane domains. Western blotting using antibodies specifically targeting either srt-55 or associated epitope tags provides more definitive confirmation of protein identity when combined with appropriate positive and negative controls. Mass spectrometry analysis, particularly liquid chromatography-mass spectrometry (LC-MS/MS), offers the most rigorous identity confirmation through peptide fingerprinting against the known srt-55 sequence as provided in the product information . Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides critical information about sample homogeneity and potential oligomerization states, which is particularly important for membrane proteins that may form functional dimers or higher-order complexes. Circular dichroism spectroscopy can provide valuable secondary structure information to confirm proper protein folding, with serpentine receptors typically exhibiting characteristic α-helical patterns consistent with their transmembrane domains.

What are optimal strategies for enhancing srt-55 expression and purification yield?

For purification, a multi-step approach typically yields the best results:

Purification StepPurposeTypical Conditions for srt-55Key Considerations
Membrane IsolationConcentrate starting materialUltracentrifugation at 100,000×gRequires careful buffer optimization to maintain native state
SolubilizationExtract protein from membranes1-2% detergent (DDM, LMNG, or GDN)Detergent choice significantly impacts downstream functionality
IMACInitial captureNi-NTA with imidazole gradientTag position affects accessibility and recovery
Size ExclusionPolishing and buffer exchangeSuperdex 200Critical for removing aggregates and detergent micelles
Ligand AffinityEnhanced purityLigand-coupled resinRequires known ligand with moderate binding affinity

How should researchers design experimental controls for srt-55 ligand binding studies?

Rigorous experimental design for srt-55 ligand binding studies requires multiple levels of controls to ensure reliable and interpretable results. Thermal shift assays represent a valuable preliminary approach for identifying potential ligands, with controls including buffer-only samples, denatured protein controls, and comparative analysis with structurally related but functionally distinct serpentine receptors from the same organism to assess binding specificity. Radioligand binding assays require particularly stringent controls, including determination of non-specific binding through competition with excess unlabeled ligand (typically 100-fold excess), validation of binding site saturation across a concentration range of 0.1-10× the expected Kd value, and demonstration of specificity through comparison binding constants with structural analogs of the putative ligand. Surface plasmon resonance experiments should incorporate reference surfaces prepared identically to test surfaces but lacking immobilized receptor, regeneration validation controls to ensure consistent surface activity across multiple binding cycles, and concentration series for kinetic analysis spanning at least 0.1-10× expected KD values.

For each binding methodology, researchers should establish:

  • Positive controls using well-characterized ligand-receptor pairs with similar biochemical properties

  • Negative controls with structurally similar non-binding molecules

  • Vehicle controls to rule out solvent effects in ligand preparations

  • Time-dependent stability controls to ensure receptor remains functional throughout the experiment duration

  • Competitive binding profiles with presumptive native ligands when available

What experimental approaches can elucidate srt-55 signaling mechanisms in cellular systems?

Elucidating srt-55 signaling mechanisms requires integrative experimental approaches combining genetic, biochemical and cell biological techniques. CRISPR-Cas9 mediated gene editing provides powerful tools for creating precise modifications in srt-55, allowing systematic structure-function analysis through generation of point mutations in key residues identified from the amino acid sequence in the product information, particularly those in cytoplasmic loop regions likely involved in G-protein coupling . G-protein coupling specificity can be systematically investigated through co-immunoprecipitation experiments using epitope-tagged srt-55 expressed in heterologous systems, followed by mass spectrometry analysis to identify interacting partners under various stimulation conditions. Bioluminescence resonance energy transfer (BRET) assays offer quantitative real-time measurement of protein-protein interactions in living cells, allowing temporal resolution of srt-55 associations with various downstream effectors including G-proteins, arrestins, and other regulatory proteins.

Second messenger assays measuring changes in cAMP, calcium, or inositol phosphates provide functional readouts of different G-protein coupling preferences:

Signaling PathwayDetection MethodExpected ResponseTemporal Resolution
Gαs CouplingFRET-based cAMP sensorsIncreased cAMPSeconds to minutes
Gαi CouplingInhibition of forskolin-stimulated cAMPDecreased cAMPSeconds to minutes
Gαq CouplingCalcium-sensitive dyes or GECO indicatorsCalcium transientsMilliseconds to seconds
β-Arrestin RecruitmentBRET/FRET biosensorsIncreased BRET signalSeconds to minutes
ERK ActivationPhospho-specific antibodiesIncreased phosphorylationMinutes to hours

What are the challenges in structural characterization of srt-55 and how can they be addressed?

Structural characterization of serpentine receptors like srt-55 presents significant technical challenges requiring specialized approaches. Cryo-electron microscopy (cryo-EM) has emerged as a particularly valuable technique for membrane protein structural studies, requiring smaller quantities of protein compared to crystallography while potentially preserving more native-like conformational states in detergent micelles or nanodiscs. Traditional X-ray crystallography approaches for srt-55 face multiple obstacles including the need for large quantities of homogeneous, stable protein and the challenge of growing well-ordered crystals of membrane proteins, though these challenges can be partially addressed through systematic screening of crystallization conditions and the use of fusion partners like T4 lysozyme or BRIL inserted into flexible loop regions to facilitate crystal contacts. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers complementary structural information about protein dynamics and ligand-induced conformational changes without requiring crystallization, providing valuable insights into the structural transitions that likely occur during activation of srt-55.

The incorporation of srt-55 into membrane-mimetic systems represents a critical consideration for structural studies:

Membrane MimeticAdvantagesDisadvantagesSuitability for srt-55
Detergent MicellesWell-established, simple preparationMay destabilize proteinGood starting point for initial trials
NanodiscsMore native-like lipid environmentComplex assembly processExcellent for functional studies
LiposomesMost native-like environmentChallenging for structural techniquesIdeal for functional validation
Lipidic Cubic PhaseSupports crystal growth in lipid environmentTechnical complexityProven successful for other GPCRs
SMALPsExtracts proteins with native lipidsLimited detergent compatibilityPromising for maintaining native interactions

How can researchers utilize computational approaches to predict srt-55 ligands and binding sites?

Computational prediction of srt-55 ligands and binding sites can accelerate experimental discovery through integration of multiple in silico methodologies. Homology modeling represents an essential first step, using the srt-55 sequence from the product information aligned against structurally characterized GPCRs, with particular attention to serpentine receptors with the highest sequence similarity in transmembrane domains where ligand binding pockets are typically located. Molecular dynamics simulations of the resulting models in membrane environments provide critical insights into conformational flexibility, potential allosteric binding sites, and the structural impact of key conserved motifs identified in sequence analysis. Virtual screening campaigns using molecular docking can efficiently evaluate large compound libraries against predicted binding pockets, with scoring functions optimized for membrane protein-ligand interactions to account for the unique physicochemical environment of the transmembrane regions.

Advanced computational approaches include:

  • Ensemble docking against multiple receptor conformations to address receptor flexibility

  • Fragment-based virtual screening focusing on core scaffolds with optimal physicochemical properties

  • Pharmacophore modeling based on known ligands of related serpentine receptors

  • Machine learning classification models trained on chemical features of GPCR ligands

  • Molecular interaction fingerprint analysis to identify key interaction patterns

Example scoring matrix for evaluating computational predictions:

Prediction MethodComputational CostSuccess Rate for GPCRsValidation Requirements
Sequence-based binding site predictionLow60-70%Experimental mutagenesis
Homology model + dockingMedium40-60% for close homologsBinding assays of top hits
MD-refined models + dockingHigh50-70%Structure-activity relationship studies
Machine learning approachesVariable30-80% depending on training dataOrthogonal computational methods
Metadynamics simulationsVery high70-90% for binding modeDetailed kinetic binding studies

How can srt-55 be utilized in comparative studies of GPCR signaling across species?

Comparative analysis of srt-55 with mammalian GPCRs provides valuable evolutionary insights into conserved mechanisms of receptor function. Phylogenetic analysis should begin with comprehensive multiple sequence alignment of srt-55 with both nematode and mammalian GPCRs, focusing particularly on conservation patterns in transmembrane domains and ligand-binding regions based on the full amino acid sequence provided in the product information . Heterologous expression studies comparing srt-55 function in mammalian cell systems versus native C. elegans cells can reveal key differences in downstream signaling machinery and coupling preferences, providing insights into the evolution of GPCR signaling networks. Cross-species chimeric receptor construction, systematically replacing domains of srt-55 with corresponding regions from mammalian receptors, allows precise identification of molecular determinants responsible for species-specific signaling properties and ligand recognition characteristics.

Comparative genomics approaches can be particularly revealing:

  • Synteny analysis examining genomic context of srt-55 across nematode species

  • Positive selection analysis to identify rapidly evolving residues potentially involved in species-specific functions

  • Co-evolution network analysis to identify correlated mutations across GPCR families

  • Transcriptional regulation comparison between srt-55 and mammalian GPCR homologs

  • Tissue expression pattern analysis across species to identify conserved versus divergent physiological roles

What methodologies are optimal for studying srt-55 trafficking and membrane localization?

Investigation of srt-55 trafficking and membrane localization requires specialized imaging and biochemical techniques adapted for membrane proteins. Fluorescence microscopy using fluorescently-tagged srt-55 constructs (typically with GFP or mCherry fused to the C-terminus to avoid disrupting the N-terminal signal sequence) provides vital information about cellular localization patterns in both heterologous expression systems and in C. elegans neurons when combined with appropriate markers for cellular compartments. Surface biotinylation assays using membrane-impermeable biotinylation reagents followed by streptavidin pulldown and immunoblotting provide quantitative measurement of surface-expressed srt-55 under various experimental conditions, allowing assessment of trafficking efficiency and stability at the plasma membrane. Antibody feeding assays with extracellular epitope-tagged srt-55 constructs can track internalization kinetics in response to stimulation, providing insights into receptor desensitization mechanisms and recycling pathways.

Advanced imaging approaches include:

TechniqueInformation ObtainedResolutionKey Advantages
TIRF MicroscopyNear-membrane dynamics~100-200 nm lateralExcellent for surface density quantification
FRAPLateral mobility in membraneRegion-specificMeasures diffusion coefficients in living cells
Single Particle TrackingIndividual receptor movement~20-50 nmReveals membrane microdomains and barriers
Super-resolution (PALM/STORM)Nanoscale organization~10-30 nmShows clustering and co-localization
Correlative Light-Electron MicroscopyUltrastructural context~2-5 nmLinks function to membrane ultrastructure

How should researchers approach the functional reconstitution of srt-55 in artificial membrane systems?

Functional reconstitution of srt-55 in artificial membrane systems requires careful optimization of lipid composition and reconstitution protocols. Systematic screening of lipid compositions represents a critical first step, typically beginning with mixtures that mimic C. elegans neuronal membranes (with particular attention to cholesterol or ergosterol content and phospholipid headgroup composition) and iteratively optimizing based on functional readouts. Detergent-mediated reconstitution protocols require careful selection of detergents that efficiently solubilize lipids while maintaining srt-55 stability, with gradual detergent removal through dialysis, adsorption to Bio-Beads, or cyclodextrin complexation allowing controlled incorporation of the receptor into forming bilayers. Direct incorporation techniques using preformed liposomes may be gentler on the protein but typically result in predominantly inward-facing receptor orientation, necessitating careful experimental design for functional studies dependent on ligand accessibility.

Functional validation of reconstituted systems should include:

  • Verification of incorporation efficiency through density gradient centrifugation

  • Assessment of protein orientation using protease protection assays

  • Measurement of ligand binding using fluorescence-based or radioligand approaches

  • Evaluation of G-protein coupling using purified G-protein components

  • Structural integrity confirmation through circular dichroism or fluorescence spectroscopy

Example reconstitution optimization matrix:

ParameterVariables to TestValidation MethodExpected Outcome
Lipid:Protein Ratio50:1 to 1000:1 (w/w)Freeze-fracture EMHomogeneous distribution without aggregation
Lipid CompositionPC/PE/PS/PI/cholesterol variationsBinding assaysMaximum functionality with native-like composition
Detergent TypeDDM, LMNG, OG, Triton X-100Receptor stability assaysMinimal activity loss during reconstitution
Removal MethodDialysis, Bio-Beads, cyclodextrinG-protein activationHighest signal-to-noise in functional assays
Buffer CompositionpH, salt concentration, stabilizersLong-term stabilityMaintained activity over extended storage

What are common pitfalls in srt-55 research and how can they be addressed?

Research with recombinant serpentine receptors like srt-55 presents several common challenges requiring systematic troubleshooting approaches. Protein aggregation represents a frequent obstacle, manifesting as multiple high-molecular-weight bands on SDS-PAGE or elution in the void volume during size exclusion chromatography, which can be addressed through optimization of detergent type and concentration, addition of specific lipids during purification, and careful temperature control throughout all processing steps. Loss of function during purification often results from detergent-induced conformational changes, requiring screening of milder detergents like GDN or LMNG, addition of stabilizing ligands during purification when available, or implementation of conformational stabilization through strategic disulfide bond engineering based on the amino acid sequence provided in the product information . Non-specific binding in interaction studies frequently complicates data interpretation, necessitating rigorous control experiments including heat-denatured receptor controls, competition assays with presumptive ligands, and careful optimization of blocking agents to minimize interactions with assay components.

Systematic approach to troubleshooting expression issues:

  • Verify construct design with attention to predicted transmembrane domain boundaries

  • Assess protein toxicity through growth curve analysis in expression host

  • Optimize induction conditions with particular focus on post-induction temperature

  • Evaluate membrane integration through fractionation studies

  • Consider alternative fusion partners or expression systems if problems persist

How can researchers design rigorous negative controls for srt-55 functional studies?

Examples of specific negative controls for different experimental approaches:

Experimental ApproachRecommended Negative ControlsPurposeImplementation Notes
Ligand Binding AssaysD/N mutations in predicted binding pocketTests binding site specificityRequires homology modeling or mutagenesis scanning
G-protein ActivationDRY motif mutations (if present in srt-55)Disrupts G-protein couplingBased on conserved GPCR signaling motifs
Cellular SignalingDominant-negative G-protein co-expressionConfirms signaling pathwayRequires knowledge of G-protein coupling preference
Trafficking StudiesER retention signal additionPrevents surface expressionC-terminal KKXX motif addition
Cross-linking StudiesNon-cross-linkable amino acid substitutionsVerifies specificity of interactionsReplace reactive residues with alanine

What considerations are important when interpreting data from heterologous expression systems versus native contexts?

Interpretation of srt-55 functional data requires careful consideration of differences between heterologous expression systems and native cellular contexts. Overexpression artifacts in heterologous systems frequently lead to aberrant trafficking, aggregation, or constitutive activity not observed at physiological expression levels, necessitating titration of expression levels and comparison of multiple expression systems with varying expression strengths. Differences in post-translational modifications between expression systems can significantly impact receptor function, particularly glycosylation patterns that may differ between insect cells, mammalian cells, and native C. elegans neurons, requiring careful analysis of modification status through mass spectrometry or mobility shift assays. G-protein coupling preferences may appear different in heterologous systems due to differences in the complement and relative abundance of available G-protein subunits, requiring co-expression of specific G-proteins or chimeric G-proteins to accurately reconstruct signaling pathways.

Key parameters that should be compared between heterologous and native systems:

  • Expression level through quantitative western blotting or flow cytometry

  • Subcellular localization through high-resolution imaging

  • Post-translational modification profiles using mass spectrometry

  • Ligand binding affinity and kinetics through radioligand or fluorescence-based assays

  • Downstream signaling dynamics using real-time second messenger assays

What emerging technologies hold promise for advancing srt-55 research?

Emerging technologies across multiple disciplines are poised to significantly advance srt-55 research in coming years. Cryo-electron tomography represents a revolutionary approach for visualizing membrane proteins in their native cellular environment, potentially allowing direct observation of srt-55 organization and clustering in neuronal membranes of C. elegans without disrupting native interactions. Advanced mass spectrometry techniques, particularly hydrogen-deuterium exchange mass spectrometry (HDX-MS) and cross-linking mass spectrometry (XL-MS), provide powerful tools for mapping ligand binding sites and conformational changes without requiring crystal structures. Single-molecule fluorescence approaches including single-molecule FRET (smFRET) and fluorescence correlation spectroscopy (FCS) offer unprecedented insights into the conformational dynamics of individual srt-55 molecules, potentially revealing transient states critical for function but invisible to ensemble measurements.

Particularly promising methodological advances include:

  • DNA-encoded library technology for rapid ligand discovery

  • Nanobody development as crystallization chaperones and conformation-specific probes

  • Photopharmacology approaches using light-controllable ligands

  • Targeted protein degradation techniques for temporal control of srt-55 function

  • Cell-free expression systems optimized for membrane protein production

How can systems biology approaches be applied to understand srt-55 function in complex cellular networks?

Systems biology approaches offer powerful frameworks for understanding srt-55 function within broader signaling networks and physiological processes. Transcriptomic profiling using RNA-sequencing in C. elegans neurons following genetic manipulation of srt-55 can reveal downstream transcriptional networks regulated by this receptor, providing insights into its physiological functions and identifying potential biological pathways affected by receptor activation or inhibition. Proteomics approaches, particularly proximity labeling techniques like BioID or APEX, can map the immediate protein interaction network surrounding srt-55 in its native membrane environment, identifying novel regulatory partners and downstream effectors that may not be detected by traditional immunoprecipitation approaches. Integration of genetic interaction data through systematic RNAi or CRISPR screens can identify synthetic lethal or synthetic rescue interactions with srt-55, revealing functional relationships with other signaling pathways and cellular processes.

Mathematical modeling approaches that may be particularly valuable include:

  • Ordinary differential equation models of srt-55 signaling dynamics

  • Agent-based modeling of receptor trafficking and membrane organization

  • Network analysis of genetic and protein interaction data

  • Multi-scale modeling linking molecular events to cellular and organismal phenotypes

  • Machine learning approaches for integrating heterogeneous experimental datasets

Through these advanced methodologies and integrated research approaches, the scientific community can continue to expand our understanding of srt-55 biology and its broader implications for serpentine receptor function across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.