Recombinant Serpentine receptor class U-26 (sru-26)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
sru-26; T04A11.12; Serpentine receptor class U-26; Protein sru-26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sru-26
Target Protein Sequence
MFTLPPVLNSSYVGIHGNSTFINFEFSFYTLPMLFLLVPILYIPITIIIILRILVKLYYA FRDRNNNVYLLSAISISQCMCLLFFLADFLYLRLPTSGLLTSWCASIEPNRFITILTIFT YHINYSTMIFPFLVSIMRLILIISPKNHKKFNGQLLRFSIPFICVYPIIFTFFMFPAIGY CSYAAYPFPFGAIIFRIERTFFGLVNNFSLLFNTLFWMTCCIITNFILLLLLIKSRCLLN AQTRSMHSYKVEVSLSLTTFSMIFSYLSNAMIVFLLLELHIVGHYASPIW
Uniprot No.

Target Background

Database Links

UniGene: Cel.28914

Protein Families
Nematode receptor-like protein sru family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class U-26 (sru-26)?

Serpentine receptor class U-26 (sru-26) is a member of the G protein-coupled receptor (GPCR) superfamily expressed in Caenorhabditis elegans. It belongs to the seven-transmembrane domain receptor family that mediates cellular responses to external stimuli. As a GPCR, sru-26 likely functions as a molecular sensor for physiological processes in C. elegans, similar to how other GPCRs serve as ubiquitous mediators of signaling for hormones, neurotransmitters, and sensing in various organisms . The receptor contains characteristic structural domains including an extracellular N-terminus, seven transmembrane helices, and intracellular loops involved in G protein coupling and downstream signaling cascades.

How does sru-26 function within the broader GPCR classification system?

Sru-26 belongs to the serpentine receptor class U subfamily within the broader GPCR superfamily, which constitutes the largest family of proteins targeted by modern drug discovery efforts . Within the GPCR classification system, serpentine receptors from C. elegans typically belong to the rhodopsin-like family (Class A), although definitive classification requires structural analyses similar to those performed for receptors such as β2-adrenergic, β1-adrenergic, A2a-adenosine, CXCR4, and dopamine D3 receptors . The functional unit of sru-26, like other GPCRs, was traditionally viewed as a one ligand/one receptor complex, but mounting evidence suggests that GPCRs form dimers or oligomers during their biosynthesis, activation, inactivation, and/or internalization, which has significant implications for understanding sru-26 function .

What is known about sru-26 expression patterns in C. elegans?

The expression of sru-26 in C. elegans likely follows tissue-specific patterns similar to other GPCRs. Based on studies of related receptors, expression may be regulated developmentally and may occur in specific neuronal subtypes, intestinal cells, or reproductive tissues. Experimental approaches to determine expression patterns typically involve creating transgenic worms with reporter genes such as green fluorescent protein (GFP) fused to the sru-26 promoter region. Similar to techniques used for other GPCRs, detection may require immunofluorescence of fixed tissue sections using specific antibodies to differentiate the reporter fluorescence from background autofluorescence . Compartmentalization of expression to specific cell types suggests specialized functions that may inform experimental design approaches.

What mechanisms underlie sru-26 oligomerization and does it impact receptor function?

Emerging evidence suggests that GPCRs like sru-26 may form functional dimers or higher-order oligomers. This represents a paradigm shift from the classical view of GPCRs functioning as monomeric units. The physiological significance of potential sru-26 oligomerization can be investigated through techniques similar to those employed for other GPCRs, including co-immunoprecipitation, resonance energy transfer methods, and functional complementation studies in transgenic models .

In experimental systems studying related GPCRs, researchers have detected receptor dimers and oligomers of approximately 120 kDa, 240 kDa, and higher molecular weights through SDS-resistant formations. These interactions appear to be specific rather than random associations with other GPCRs. For instance, when investigators co-expressed FLAG-tagged and HA-tagged receptor mutants in HEK-293 cells, immunoprecipitation with FLAG antibodies revealed both monomers and SDS-resistant dimers, but only when both mutants were expressed in the same cells, not when extracts from separately expressing cells were combined post-lysis .

How does functional complementation inform our understanding of sru-26 signaling?

Functional complementation studies represent a powerful approach to understanding sru-26 signaling mechanisms. Drawing from research on related GPCRs, this approach involves creating transgenic systems expressing two distinct mutant forms of the receptor – typically one binding-deficient mutant and one signaling-deficient mutant. The restoration of receptor function through intermolecular cooperation between these mutants provides compelling evidence for physiologically relevant dimerization or oligomerization .

For example, in studies with the luteinizing hormone receptor (LHR), researchers demonstrated that co-expression of a mutant with an inactivating mutation in the ligand binding domain and another mutant with deletion of transmembrane helices 6 and 7 (involved in G protein coupling) could restore receptor function through intermolecular complementation. This was confirmed through:

  • Phenotypic rescue in transgenic mice

  • Direct measurement of signaling outputs (cAMP production)

  • Binding assays showing physical interaction between the mutants

  • Confirmation that the effect was not due to trafficking rescue but to direct cooperation at the cell membrane

Similar experimental paradigms could be employed to investigate whether sru-26 functions through comparable intermolecular cooperation mechanisms.

What are the structural determinants of ligand binding specificity in sru-26?

The structural determinants of ligand binding in sru-26 likely reside within its extracellular domains, particularly the N-terminal region and extracellular loops. Based on studies of related GPCRs, critical residues such as cysteine residues may play essential roles in maintaining the three-dimensional structure necessary for ligand recognition .

Experimental approaches to identify these determinants include:

  • Site-directed mutagenesis of conserved residues in the extracellular domain

  • Creation of chimeric receptors with related serpentine receptors

  • Molecular dynamics simulations based on homology models of sru-26 structure

  • Binding assays with recombinant receptor variants expressed in heterologous systems

For instance, in studies of LHR, an inactivating Cys22 to Ala22 mutation in the ligand binding extracellular domain abolished ligand binding without affecting receptor trafficking, illustrating how specific residues can be critical for ligand recognition while dispensable for structural integrity .

What expression systems are optimal for producing recombinant sru-26 for structural studies?

Production of recombinant sru-26 for structural and functional studies presents considerable technical challenges similar to those encountered with other GPCRs. Several expression systems warrant consideration:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, low cost, rapidPoor for membrane proteins, lacks post-translational modificationsPartial domains, fusion proteins
Yeast (P. pastoris)Eukaryotic processing, moderate yieldMay have different lipid environmentFunctional studies, ligand screening
Insect cellsHigher eukaryotic processing, good for GPCRsMore expensive, slowerStructural studies, antibody production
Mammalian cells (HEK293, CHO)Native-like processing and foldingLower yield, highest costSignaling studies, protein-protein interactions

The choice of expression system should be guided by the specific research questions. For crystallography or structural analyses, insect cell systems have proven successful for related GPCRs . For functional complementation studies, mammalian expression systems provide appropriate cellular machinery for proper folding and trafficking . The recombinant protein should include appropriate tags for purification and detection, while ensuring these additions do not interfere with receptor function.

How can conformational flexibility of sru-26 be assessed for structure-function studies?

Conformational flexibility represents one of the greatest technical and theoretical challenges in elucidating GPCR structure-function relationships. For sru-26, methodological approaches to assess this flexibility include:

  • Crystallography under various conditions (with different ligands or G protein mimetics)

  • Cryo-electron microscopy to capture different conformational states

  • Molecular dynamics simulations to model transitions between states

  • Spectroscopic approaches such as FRET or BRET to measure conformational changes in real-time

  • Functional complementation assays with strategically designed mutants

The subtle conformational changes triggered by relatively small binding energy effects can lead to full or partial efficacy in activation or inactivation of the receptor system. These changes manifest through kinetic modulation of interactions with G proteins, arrestins, and other effector molecules . Understanding this conformational landscape is essential for rational design of ligands with specific pharmacological properties.

What strategies overcome the challenges in crystallizing serpentine receptors like sru-26?

Crystallization of GPCRs like sru-26 has historically presented significant challenges due to their inherent flexibility, hydrophobicity, and instability when removed from the membrane environment. Based on successful approaches with other GPCRs, several strategies may facilitate sru-26 crystallization:

  • Fusion with stabilizing proteins (T4 lysozyme, BRIL) to reduce conformational heterogeneity

  • Thermostabilizing mutations identified through alanine scanning

  • Use of conformationally selective antibodies or nanobodies as crystallization chaperones

  • Lipidic cubic phase crystallization to maintain a membrane-like environment

  • Selection of detergents that maintain receptor stability and monodispersity

The accelerated rate at which GPCR structures are now appearing suggests that many roadblocks historically associated with crystallizing this protein family have been overcome. These methods applied to sru-26 would potentially illuminate at atomic resolution how this important membrane protein functions, significantly changing empirical approaches to understanding its biology .

How does sru-26 research contribute to broader understanding of GPCR biology?

Research on sru-26 contributes to our fundamental understanding of GPCR biology through several mechanisms:

  • As a member of the serpentine receptor class in C. elegans, sru-26 studies provide evolutionary insights into GPCR diversification and specialization

  • The simpler nervous system of C. elegans offers advantages for mapping receptor functions in defined neural circuits

  • The genetic tractability of C. elegans facilitates in vivo studies of receptor function that complement cell culture experiments

  • Insights into sru-26 dimerization or oligomerization would add to the growing evidence challenging the classical one ligand/one receptor paradigm of GPCR function

The study of receptor-receptor and receptor-effector interactions in sru-26 may reveal conserved principles applicable to the broader GPCR superfamily, which constitutes the largest family of proteins targeted in drug discovery .

What data management approaches are recommended for sru-26 research projects?

Comprehensive data management for sru-26 research projects should follow NIH guidelines for reproducibility and transparency. Based on NIH data table formats for predoctoral research programs, the following organizational structure is recommended:

Data CategoryElements to IncludeFormatAccess Considerations
Expression dataTissue specificity, developmental timingStandardized tables with statistical analysesDeposited in public repositories
Interaction studiesCo-IP results, FRET/BRET measurementsRaw data and processed resultsInclude negative controls
Functional assaysDose-response curves, EC50 valuesGraphical plus tabular dataInclude technical replicates
Structural dataCrystallography, modelingPDB format, validation reportsDeposited in structural databases

For NIH-funded research on sru-26, investigators should prepare data tables that document research training parameters, participating faculty members, and related support . This structured approach ensures that data from sru-26 studies can be effectively compared across laboratories and integrated into the broader knowledge base of GPCR biology.

What are promising future directions for sru-26 functional studies?

Several promising research directions could advance our understanding of sru-26 function:

  • CRISPR-Cas9 genome editing to create precise mutations in endogenous sru-26

  • Optogenetic approaches to control sru-26 activation with spatial and temporal precision

  • Single-cell transcriptomics to identify downstream signaling pathways

  • In vivo imaging of sru-26-expressing cells during C. elegans behaviors

  • Functional complementation studies with mutant receptors to test oligomerization hypotheses

The application of these advanced methodologies could reveal novel aspects of sru-26 function in its native context. Additionally, comparative studies with mammalian GPCRs could illuminate evolutionarily conserved mechanisms of receptor function and regulation, potentially identifying new therapeutic targets in human disease contexts where related GPCRs play crucial roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.