Recombinant Serpentine receptor class V-1 (srv-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
srv-1; srg-12; R13F6.3; Serpentine receptor class V-1; Protein srv-1; Protein srg-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srv-1
Target Protein Sequence
MTIAFLDVAITIEYVSTAISLVCLPINILFVYILFVERNRPPYNTPFFRLCIHLSIADIL MELFSTFFFKFPSFGVFPSTFYKENWSVVPIAGMQYLGHAQAFGIIFIAVNRFTAVHYPI KHRQQWWTPKVTKTLLLIQWITPLFFMAPLFSTDFKFLFSHNSGSVIFAASDARFHKNYF LAMAMVDGILINLIVLLLYGAIFIRVHTHVVVRKPGELALRLALSAFIIFICYLALGVCS LLSALTPPPDAWVYRTMWFVVNDVLCNSSALVLLALNRPIRKAFTRHLGVFSYQGVSTKN HNSLLQAV
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_R13F6.3

STRING: 6239.R13F6.3

UniGene: Cel.10116

Protein Families
Nematode receptor-like protein srv family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the SRV-1 pseudoknot and why is it important in viral biology?

The SRV-1 pseudoknot exhibits a classical H-type fold that forms a triple helix through interactions between loop 2 and the minor groove of stem 1. These interactions involve base-base and base-sugar contacts, including a distinctive ribose zipper motif not previously identified in pseudoknots. The structure is further stabilized by a stack of five adenine bases and a uracil in loop 2, which forces a cytidine to bulge .

This pseudoknot structure plays a critical role in programmed ribosomal frameshifting, a translational recoding mechanism that viruses use to control expression of the Gag-Pol polyprotein from overlapping gag and pol open reading frames. Understanding this structure provides insights into how viruses regulate gene expression .

How does the SRV-1 pseudoknot structure compare to other known viral pseudoknots?

The SRV-1 pseudoknot exhibits the typical topology seen in other H-type pseudoknot structures but has several unique features:

PseudoknotDistinguishing FeaturesStructural Similarities
SRV-1Single ribose zipper motif, extensively stacked adenines in L2, no intercalated base at junctionTriple helix formation, L2-S1 interactions
TYMVDifferent loop-stem interactionsSimilar compact conformation
BWYVDifferent tertiary interactionsTriple helix formation

The SRV-1 pseudoknot structure demonstrates that efficient frameshifting can occur without an intercalated base at the junction of the two stems. The two stems stack upon each other with a helical twist of approximately 49° at the junction, allowing proper alignment and close approach of the three different strands .

What NMR-based approaches are optimal for studying SRV-1 pseudoknot structures?

For optimal NMR experiments on SRV-1 pseudoknots, researchers should consider the following methodological approaches:

  • Design of optimized sequences: Create sequences with strategic mutations that maintain frameshift efficiency while improving NMR spectral quality. For instance, changing a G-C base pair to an A-U base pair in stem 2 helps distinguish the two G-C rich stems and prevents alternative structure formation .

  • Prevention of multimer formation: Carefully monitor concentration-dependent behavior of imino proton resonances (between 10 and 300 μM) to detect potential multimer formation. If multimers are observed, strategic nucleotide substitutions, such as changing G20 to cytidine, can destabilize intermolecular interactions like sheared tandem G-A base-pair motifs .

  • Verification of structural integrity: After modifications, validate that the frameshift efficiency remains comparable to wild-type levels through functional assays. For example, the triple mutant pk102 maintained 24% frameshift efficiency compared to the wild-type level of 23% .

How can researchers accurately model synonymous rate variation (SRV) when testing for selection in viral sequences?

When analyzing selection in viral sequences like SRV-1, researchers must account for synonymous rate variation (SRV) to avoid false positives. Implementation should follow these methodological steps:

  • Model comparison: Employ statistical models that explicitly account for SRV, such as BUSTED[S], rather than simpler models like BUSTED. This is crucial as failing to account for even moderate levels of SRV can produce intolerably high false positive rates .

  • Quantification of SRV impact: Calculate the coefficient of variation (CV) for synonymous rates. Research shows that alignments with higher SRV (median CV of 0.65 with IQR of 0.56-0.78) significantly benefit from models that account for this variation .

  • Statistical validation: Compare models using appropriate statistical criteria such as AICc (Akaike Information Criterion with correction). Studies show BUSTED[S] outperforms simpler models by a median margin of 112 AICc points when SRV is present .

The relationship between SRV magnitude and false positives is illustrated in the following data-driven observation:

SRV Level (CV)Impact on Standard MethodsRecommendation
Near zeroSimilar rejection rates between methodsEither model acceptable
Moderate (0.3-0.6)Increasing false positives in methods not accounting for SRVUse SRV-aware models
High (>0.6)2-3 fold higher detection rates (likely false positives)SRV-aware models essential

What strategic mutations should be introduced when designing SRV-1 pseudoknot constructs for structural studies?

When designing SRV-1 pseudoknot constructs for structural studies, researchers should implement the following strategic mutations:

  • Stem differentiation mutations: Change the third G-C base-pair in stem 2 to an A-U base-pair. This modification serves two critical purposes:

    • It enables spectroscopic distinction between the two G-C rich stems

    • It prevents potential rearrangement into alternative hairpin structures that could compromise structural analysis

  • Loop optimization: Consider deleting the three GCU residues in loop 2 if they aren't critical for the research question. Studies have shown that this modification actually increases frameshift efficiency from 23% to 30% compared to wild-type .

  • Multimerization prevention: If concentration-dependent behavior is observed in spectroscopic analyses, replace G20 with cytidine to prevent formation of intermolecular sheared tandem G-A base-pair motifs. This modification maintains frameshift efficiency (24%) while ensuring monomeric behavior optimal for structural studies .

These targeted modifications have been validated to maintain biological function while optimizing structural analyses, demonstrating the flexibility of certain regions of the pseudoknot structure for experimental manipulation.

How should researchers design control experiments when investigating the role of tertiary interactions in SRV-1 pseudoknot stability?

When investigating tertiary interactions in SRV-1 pseudoknot stability, robust control experiments should be implemented through this methodological framework:

How should researchers address contradictory data when studying SRV-1 pseudoknot function?

When encountering contradictory data in SRV-1 pseudoknot research, implement this structured analytical approach:

  • Thorough data examination: Systematically analyze all findings to identify specific discrepancies between expected and observed results. Pay particular attention to outliers that may have influenced results and compare data with existing literature on similar pseudoknot structures .

  • Methodological reevaluation: Consider whether the contradictions stem from:

    • Differences in experimental conditions compared to previous studies

    • The sensitivity of pseudoknot structures to subtle sequence variations

    • Limitations in structural analysis techniques

  • Alternative hypothesis development: The SRV-1 pseudoknot literature demonstrates how contradictions can lead to new insights. For example, initial mutational studies suggested SRV-1 lacked L2-S1 interactions found in other pseudoknots, but later structural studies revealed these interactions do exist but are mediated through different mechanisms .

  • Refined experimentation: Design targeted experiments to specifically address the contradictions, such as:

    • More extensive mutational analysis at critical positions

    • Alternative structural probing methods

    • Comparative analysis with related pseudoknot structures

What statistical approaches are recommended when analyzing selection patterns in SRV-1 sequences?

When analyzing selection patterns in SRV-1 sequences, researchers should implement these advanced statistical approaches to ensure accurate interpretation:

  • Synonymous rate variation (SRV) modeling: Explicitly incorporate SRV into statistical testing procedures using models such as BUSTED[S]. Research demonstrates that traditional methods may interpret variation in synonymous rates as false signals for positive selection .

  • Model selection framework: Compare models with and without SRV components using appropriate information criteria:

    • Calculate AICc scores for competing models

    • Consider a difference of >10 points as strong evidence favoring the more complex model

  • Effect size quantification: Calculate the coefficient of variation (CV) for synonymous rates to quantify SRV magnitude. Studies show the median CV for synonymous rates was 0.65 (IQR: 0.56, 0.78) in alignments where SRV models were statistically favored .

  • Power analysis: Be aware that as levels of SRV increase beyond moderate values, both standard and SRV-aware methods may lose statistical power, possibly due to saturation effects. This pattern holds across varying codon and sequence lengths .

The following data illustrates the impact of SRV on false positive rates:

SRV MagnitudeMethod ComparisonStatistical Implications
Minimal SRVBUSTED and BUSTED[S] yield identical resultsBoth methods equally valid
Moderate SRVBUSTED detection rates exceed BUSTED[S]Potential false positives with standard methods
High SRVDetection rates diverge by 2-3 foldStandard methods produce substantial false positives

What are the most promising approaches for investigating the mechanistic role of SRV-1 pseudoknots in frameshifting?

Future research into SRV-1 pseudoknot frameshifting mechanisms should prioritize these methodological approaches:

  • Structural analyses of mutant pseudoknots: Conduct NMR or crystallography studies not only on wild-type sequences but also on mutant pseudoknots with altered frameshift efficiencies. This is essential for understanding how subtle structural changes in loops and bulges affect function, as current knowledge of these elements remains limited .

  • Integrated ribosomal interaction studies: Develop experimental systems to directly observe how the pseudoknot interacts with the translating ribosome, as the actual mechanism of pseudoknot-induced frameshifting remains unclear despite extensive structural and functional data .

  • Comparative structural biology: Expand structural studies to compare pseudoknots across different retroviruses that demonstrate varying frameshift efficiencies. This approach can reveal how pseudoknot structures have evolved to fine-tune frameshifting rates for optimal viral replication in different hosts .

  • Quantitative structure-function relationships: Develop mathematical models that correlate specific structural parameters (such as helical twist at the junction, minor groove opening of stem 1, and orientation of stem 2) with frameshift efficiency to establish predictive frameworks .

How can advanced modeling address the challenges of interpreting site-to-site rate variation in SRV-1 genomic analyses?

Advanced modeling approaches for site-to-site rate variation in SRV-1 genomic analyses should incorporate:

  • Multi-factor models: Develop statistical frameworks that simultaneously account for synonymous rate variation (SRV) and other confounding factors. Current research shows that SRV cannot be explained as a simple correlate of other data features such as sequence length, tree length, or selection intensity .

  • Bayesian approaches: Implement Bayesian methodologies that can incorporate prior knowledge about the distribution of synonymous rates across viral genomes, allowing more robust inference in the presence of limited data.

  • Simulation-based validation: Use simulation studies to establish reliable thresholds for SRV effects. Research has demonstrated that the impact of SRV on false positive rates is directly related to its magnitude, with minimal effects at low SRV levels but substantial false positives at higher levels .

  • Integrated phylogenetic approaches: Develop methods that simultaneously model selection pressures and site-to-site rate variation across the phylogenetic tree, accounting for the complex evolutionary history of retroviruses like SRV-1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.