Recombinant Serpentine receptor class X 45 (srx-45)

What is Serpentine Receptor Class X 45 (srx-45) and where is it found?

Serpentine receptor class X 45 (srx-45) is a G-protein coupled receptor (GPCR) that belongs to the chemoreceptor family in Caenorhabditis elegans. It is encoded by the srx-45 gene with the Open Reading Frame (ORF) designation K01B6.2 and has a UniProt identifier of P34490. The receptor is part of the extensive GPCR system in C. elegans, which comprises over 1300 predicted GPCR-encoding genes . Serpentine receptors are characterized by their seven transmembrane domains and function as cellular signaling molecules that respond to external stimuli and translate them into intracellular responses. As a chemoreceptor, srx-45 is likely expressed in chemosensory neurons and may play a role in chemosensation and environmental signal processing based on expression patterns of similar receptors in this organism .

What is the protein structure and sequence characteristics of srx-45?

The full-length srx-45 protein consists of 361 amino acids with a sequence beginning with MFQILMENVEVQHIDRIAALLIFFTSFIGFACNTFIAFYIRRLSLLRNSFGRLLQLQAAG and continuing through to QFRSVLRHPCRSQEALNISKTPSRRSRFTTNRDESNRKKSSILACTFISNSNTGYGSSVHV . Like other GPCRs, srx-45 contains the characteristic seven transmembrane domains that are hydrophobic in nature and span the cell membrane. The protein contains regions that interact with G proteins for downstream signal transduction. The conserved structural elements include extracellular N-terminus regions that may be involved in ligand binding, three extracellular loops, three intracellular loops that typically interact with G proteins, and a cytoplasmic C-terminus that often contains regulatory phosphorylation sites. Understanding these structural features is essential for functional studies and for designing experiments to investigate receptor-ligand interactions.

How does srx-45 compare to other serpentine receptors in C. elegans?

In C. elegans, serpentine receptors are divided into multiple classes based on sequence homology and structural features. The srx family, to which srx-45 belongs, represents one of several chemoreceptor subfamilies in this organism. The C. elegans genome contains a remarkably large number of GPCR-encoding genes (more than 1300) compared to other organisms, reflecting the importance of chemosensation in nematode biology . These receptors show extensive diversity and potential functional redundancy, which has been a challenge in studying their individual roles. Many of these receptors are expressed in chemosensory neurons based on single-cell transcriptomics analysis . Recent comprehensive studies using CRISPR/Cas9 genome editing have targeted 1654 GPCR-encoding genes, including members of the srx family, to better understand their functions in various biological processes such as responses to environmental signals, pathogen detection, and volatile odorant sensing .

What experimental approaches are most effective for studying srx-45 function in vivo?

For investigating srx-45 function in vivo, a multi-faceted approach combining genetic manipulation, imaging, and behavioral assays yields the most comprehensive results. CRISPR/Cas9 genome editing has emerged as a powerful tool for generating precise genetic modifications to study GPCR function in C. elegans . This approach allows for the creation of knockout mutants, as well as the introduction of fluorescent tags for protein localization studies, similar to the UNC-45::GFP fusion approach described for studying muscle proteins .

For researchers facing the challenge of functional redundancy among closely related GPCRs, a strategy that involves targeting multiple genes encoding related receptors in individual strains has proven effective . This approach has successfully identified GPCRs with partial redundancy in functions related to environmental responses, including hypoxia response and pathogen detection.

Experimental design should include:

• Generation of single and multiple gene knockouts using CRISPR/Cas9

• Creation of fluorescent protein fusions for localization studies

• Behavioral assays to assess phenotypic changes in response to relevant stimuli

• Electrophysiological measurements to directly assess channel activity

• Calcium imaging to monitor neural activity in response to potential ligands

How can the ligand(s) for srx-45 be identified and characterized?

Identifying ligands for orphan GPCRs like srx-45 remains a significant challenge in the field. A systematic deorphanization strategy combines in vitro and in vivo approaches:

In vitro approaches include:

• Heterologous expression systems (HEK293, CHO cells) expressing srx-45 coupled with calcium flux or cAMP assays to screen candidate ligands

• Surface plasmon resonance or isothermal titration calorimetry to measure direct binding affinities

• Receptor internalization assays following ligand exposure

In vivo approaches include:

• Calcium imaging in specific neurons expressing srx-45 in response to candidate compounds

• Behavioral assays using wild-type and srx-45 mutant worms exposed to candidate ligands

• Chemotaxis assays to test attraction or repulsion to potential ligands

Recent comprehensive mutant libraries of GPCRs and neuropeptides in C. elegans provide valuable resources for expediting the deorphanization process . By screening srx-45 knockout strains against a range of environmental signals and comparing their responses to wild-type worms, researchers can identify potential physiological roles and ligands. This approach has successfully identified neuropeptides that interact with specific receptors in hypoxia-evoked locomotory responses and receptors for volatile food-related odorants .

What are the experimental challenges in resolving potential functional redundancy between srx-45 and related receptors?

Functional redundancy among GPCRs presents a significant challenge in C. elegans research due to the large number of receptors and their sequence similarities. Recent methodological advances offer strategies to address this challenge:

• Multiple gene targeting: Creating strains with mutations in multiple related receptors has proven effective in identifying redundant functions. For example, a strain with disruptions in five related genes (dmsr-4, dmsr-5, dmsr-6, dmsr-7, and dmsr-8) revealed defects in hypoxia-evoked arousal that were not evident in single mutants .

• Systematic screening approaches: Comprehensive screening of mutant strains for their responses to various environmental signals can reveal phenotypes masked by redundancy. This approach successfully identified GPCRs involved in hypoxia response, pathogen detection, and odorant sensing .

• Expression pattern analysis: Single-cell transcriptomics can identify co-expression of multiple receptors in the same neurons, suggesting potential redundancy .

• Domain-swapping experiments: Creating chimeric receptors by swapping domains between srx-45 and related receptors can help identify functional domains responsible for specific ligand interactions or signaling properties.

• Quantitative phenotyping: Employing sensitive, quantitative assays that can detect subtle phenotypic changes may reveal partial contributions of individual receptors in redundant systems.

The challenge of redundancy is particularly relevant for chemoreceptor families like srx, where closely related members may have overlapping functions in sensing similar environmental cues. This redundancy likely evolved as a mechanism to ensure robust sensory perception in varying environmental conditions.

What are the optimal conditions for handling recombinant srx-45 protein in laboratory settings?

Optimal handling of recombinant Serpentine receptor class X 45 (srx-45) protein requires careful attention to storage and working conditions to maintain protein stability and functionality:

Storage Recommendations:

• Store the protein at -20°C for general storage

• For extended storage periods, conserve at -20°C or -80°C

• Avoid repeated freezing and thawing cycles as this can lead to protein denaturation

• Prepare working aliquots and store at 4°C for up to one week

Buffer Composition:

• The optimal buffer system is a Tris-based buffer containing 50% glycerol, specifically optimized for this protein

• This composition helps maintain protein stability and prevents aggregation

Handling Procedures:

• When thawing frozen protein, do so rapidly by placing on ice

• For experiments, dilute the protein in the appropriate buffer immediately before use

• Maintain cold chain throughout experiments when possible

• If using for binding studies or functional assays, avoid multiple freeze-thaw cycles by preparing single-use aliquots

Following these guidelines will help ensure that the recombinant srx-45 protein maintains its native conformation and activity for experimental applications.

What expression systems and purification strategies yield the highest quality recombinant srx-45 for structural studies?

For high-quality recombinant srx-45 production suitable for structural studies, researchers should consider the following expression systems and purification strategies:

Expression Systems:

• Bacterial Systems (E. coli):

  • Benefits: High yield, cost-effective, rapid production

  • Limitations: Membrane proteins like GPCRs often misfold or form inclusion bodies

  • Recommendation: Use specialized strains (C41/C43) with fusion tags (MBP, SUMO) to enhance solubility

• Insect Cell Systems:

  • Benefits: Superior post-translational modifications compared to bacteria

  • Recommendation: Baculovirus expression in Sf9 or High Five cells has proven successful for many GPCRs

• Mammalian Cell Systems:

  • Benefits: Native-like post-translational modifications and folding machinery

  • Recommendation: HEK293, CHO cells with inducible expression systems

Purification Strategies:

• Affinity Chromatography:

  • Use of appropriate tags determined during the production process

  • Options include His6, FLAG, or specialized GPCR-specific tags

• Detergent Solubilization:

  • Mild detergents like DDM, LMNG, or GDN preserve GPCR structure

  • Nanodiscs or lipid cubic phase for maintaining native-like environment

• Size Exclusion Chromatography:

  • Critical final step to ensure homogeneity required for structural studies

  • Buffer optimization to prevent aggregation

• Stabilization Approaches:

  • Thermostabilizing mutations

  • Nanobodies or conformational antibodies to lock receptors in specific states

For quality assessment, employ multiple techniques including SDS-PAGE, Western blotting, mass spectrometry, and functional binding assays to verify both purity and activity of the purified receptor.

How can antibodies against srx-45 be developed and validated for immunolocalization studies?

Developing reliable antibodies against srx-45 for immunolocalization studies requires a systematic approach to production and validation:

Antigen Design Strategies:

• Peptide-based approach:

  • Select unique epitopes from the N-terminal or C-terminal regions of srx-45 that have high antigenicity

  • Avoid transmembrane domains which are difficult to access in native proteins

  • Example: A practical approach similar to that used for UNC-45 involved selecting a distinctive region (58-residue region from amino acid 18 to 76)

• Fusion protein approach:

  • Express a fragment of srx-45 as a fusion with glutathione S-transferase or other soluble tags

  • This approach has been successful for other C. elegans proteins

Production Methods:

• Generate the selected antigen using recombinant expression

• Immunize rabbits or other host animals following standard protocols

• Purify the resulting antisera using affinity chromatography with the immunizing antigen

Validation Techniques:

• Western blotting:

  • Verify antibody specificity against wild-type lysates and srx-45 mutants

  • Include preimmune serum controls to ensure specificity

• Immunofluorescence validation:

  • Compare staining patterns in wild-type versus srx-45 knockout animals

  • Perform competition assays with the immunizing peptide

• Alternative validation:

  • Use CRISPR/Cas9 to generate GFP-tagged srx-45 and confirm colocalization with antibody staining

  • Validate in heterologous expression systems overexpressing srx-45

The most rigorous validation includes demonstrating absence of signal in genetic null mutants while showing appropriate signal in wild-type animals, as well as confirming subcellular localization patterns that align with predicted receptor distribution.

How does srx-45 fit into the broader GPCR signaling networks in C. elegans?

Serpentine receptor class X 45 (srx-45) functions within the extensive GPCR signaling network in C. elegans, which comprises more than 1300 predicted GPCR-encoding genes . This network represents one of the most complex chemosensory systems in any model organism and plays crucial roles in numerous biological processes.

Signaling Network Components:

Functional Integration:
As a member of the chemoreceptor family, srx-45 likely participates in specific sensory circuits. Recent systematic studies of GPCR function in C. elegans have identified roles for serpentine receptors in several key processes:

• Environmental sensing: GPCRs respond to various stimuli including chemicals, temperature, and oxygen levels

• Pathogen detection: Several GPCRs function in immune response pathways against pathogens

• Food detection: Receptors for volatile food-related odorants contribute to foraging behaviors

• Physiological regulation: GPCRs respond to neuropeptides that regulate diverse physiological processes

To fully understand srx-45's position within these networks, researchers would need to determine its expression pattern, identify its ligand(s), and characterize its downstream signaling pathways. The comprehensive mutant libraries now available for C. elegans GPCRs provide valuable tools for placing srx-45 within specific functional networks through systematic screening approaches .

What computational approaches can predict potential ligands and functional roles for srx-45?

Computational approaches offer powerful tools for predicting potential ligands and functional roles for orphan GPCRs like srx-45:

Structure-Based Approaches:

• Homology modeling: Generate 3D structural models of srx-45 based on crystallized GPCRs with similar sequences

• Molecular docking: Screen virtual libraries of compounds against the predicted binding pocket

• Molecular dynamics simulations: Evaluate stability of ligand-receptor complexes and conformational changes

Sequence-Based Approaches:

• Phylogenetic analysis: Group srx-45 with characterized receptors based on evolutionary relationships

• Motif identification: Identify conserved sequence motifs associated with specific ligand classes

• Machine learning algorithms: Train models on known GPCR-ligand pairs to predict potential srx-45 ligands

Network-Based Predictions:

• Co-expression analysis: Identify genes co-expressed with srx-45 across tissues or conditions

• Pathway enrichment: Determine biological pathways enriched among co-expressed genes

• Protein-protein interaction networks: Predict functional associations based on interaction partners

Integration of Experimental Data:
Combining computational predictions with experimental data enhances accuracy:

These computational approaches can generate testable hypotheses about srx-45 function that can then be validated through experimental approaches. The recent comprehensive identification of GPCRs in C. elegans provides a valuable foundation for these computational analyses by establishing the complete repertoire of receptors and their relationships .

How can contradictory experimental results regarding srx-45 function be reconciled through meta-analysis?

When facing contradictory experimental results regarding srx-45 function, a structured meta-analytical approach can help reconcile discrepancies and develop a more cohesive understanding:

Sources of Experimental Variation:

• Genetic background differences: Even minor variations in strain background can affect GPCR function

• Environmental conditions: Temperature, media composition, and bacterial food source can influence receptor activity

• Methodological differences: Variations in assay sensitivity, timing, and quantification methods

• Functional redundancy: Compensatory mechanisms may mask phenotypes in different experimental setups

Meta-Analysis Framework:

Reconciliation Strategies:

• Functional context hypothesis: Contradictory results may reflect context-dependent functions of srx-45 in different cells or conditions

• Dose-response relationships: Varying levels of receptor stimulation may yield qualitatively different outcomes

• Temporal dynamics: Consider whether differences reflect acute versus chronic responses

• Multifunctional receptor hypothesis: srx-45 may couple to different G proteins or signaling pathways in different contexts

The comprehensive approach to studying GPCR function in C. elegans, as demonstrated by recent work using CRISPR/Cas9 to disrupt multiple related genes simultaneously, provides a powerful framework for resolving contradictions . By systematically testing srx-45 function in defined genetic backgrounds and under standardized conditions, researchers can develop a more unified model of its biological roles.

What are the most promising future research directions for understanding srx-45 biology?

The exploration of Serpentine receptor class X 45 (srx-45) biology offers several promising research directions that could significantly advance our understanding of GPCR function in C. elegans and potentially provide insights relevant to human biology:

• Comprehensive deorphanization: Identifying the endogenous ligand(s) for srx-45 remains a fundamental goal. The development of high-throughput screening approaches using the CRISPR-generated mutant libraries will accelerate this process .

• Circuit-level analysis: Mapping the neural circuits in which srx-45 functions will provide context for understanding its sensory role. Combining optogenetics with calcium imaging in defined neurons can elucidate how srx-45 signaling integrates into broader neural networks.

• Evolutionary conservation: Comparative analysis of srx-45 function across nematode species could reveal evolutionary conservation or divergence of chemosensory mechanisms. This approach may identify fundamental principles of chemoreception that extend beyond C. elegans.

• Integration with human health research: While direct orthologs of srx-45 may not exist in humans, the signaling mechanisms and principles of GPCR function are highly conserved. Insights from srx-45 could inform our understanding of human GPCR biology relevant to disease and drug development.

• Synthetic biology applications: Engineered versions of srx-45 could potentially serve as biosensors for specific compounds, offering applications in environmental monitoring or medical diagnostics.