Recombinant Serratia proteamaculans Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Role

The recombinant Serratia proteamaculans Arginine exporter protein ArgO (argO) is a specialized transporter involved in the efflux of arginine, a critical amino acid for bacterial metabolism and stress response. Originally identified in Escherichia coli as YggA (later renamed ArgO), this protein belongs to the LysE family of exporters and regulates intracellular arginine levels to prevent toxicity caused by accumulation or external antimetabolites like canavanine . In S. proteamaculans, ArgO shares structural and functional homology with its E. coli counterpart, playing a role in maintaining amino acid homeostasis and resistance to arginine analogs .

Biotechnological Applications

  • Industrial Biotechnology: Recombinant ArgO could optimize arginine production in microbial cell factories by enhancing efflux, reducing feedback inhibition .

  • Antimicrobial Research: Targeting ArgO may disrupt bacterial amino acid balance, offering a strategy against pathogens relying on arginine metabolism .

  • Commercial Availability: Sold as an ELISA-ready reagent (e.g., Cusabio product CSB-CF420542STJ), enabling antibody development and functional assays .

Research Gaps and Future Directions

  • Mechanistic Studies: Structural resolution (e.g., cryo-EM) of S. proteamaculans ArgO is needed to clarify transport mechanisms.

  • Pathogenicity Link: While S. proteamaculans is studied for enzymes like laccases and proteases , ArgO’s role in virulence remains unexplored.

  • Engineering Potential: Modulating argO expression could enhance arginine yields in industrial strains or improve stress tolerance in synthetic biology applications .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
argO; Spro_3927; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
argO
Target Protein Sequence
MLAVFLQGFALSAAMILPLGPQNVFVMNQGIRRQYHLMVASLCALSDIVLICGGIFGGSA LLSRSPLLLALVTWGGVAFLLWYGWGAFRTAFSRQLALATAEELKQSRWRLVVTMLAVTW LNPHVYLDTFVVLGSLGGQLTPDVRSWFALGAVSASVVWFFALALLASWLAPWLKTQMAQ RIINTLVGVVMWGIALQLAWQGASL
Uniprot No.

Target Background

Function
ArgO, the arginine exporter protein from Serratia proteamaculans, is involved in the export of arginine. Its function is crucial for controlling intracellular arginine levels and maintaining the appropriate balance between arginine and lysine.
Database Links
Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Serratia proteamaculans ArgO protein?

Serratia proteamaculans ArgO is a membrane-associated protein consisting of 205 amino acids with a molecular structure characteristic of transmembrane transporters. The amino acid sequence (mLAVFLQGFALSAAMILPLGPQNVFVMNQGIRRQYHLMVASLCALSDIVLICGGIFGGSALLSRSPLLLALVTWGGVAFLLWYGWGAFRTAFSRQLALATAEELKQSRWRLVVTmLAVTWLNPHVYLDTFVVLGSLGGQLTPDVRSWFALGAVSASVVWFFALALLASWLAPWLKTQMAQRIINTLVGVVMWGIALQLAWQGASL) indicates multiple hydrophobic regions typical of transmembrane domains . The protein is encoded by the argO gene (locus Spro_3927) in Serratia proteamaculans strain 568, and is cataloged in UniProt with accession number A8GIT2 .

What are the optimal storage and handling conditions for recombinant ArgO protein preparations?

For recombinant ArgO protein preparations, optimal storage conditions include maintaining the protein in a Tris-based buffer with 50% glycerol at -20°C for routine storage, with extended storage recommended at -80°C . It is critical to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and function. For working solutions, aliquots should be stored at 4°C and used within one week to maintain optimal activity . When designing experiments, researchers should account for the membrane-associated nature of this protein and consider including appropriate detergents or reconstitution systems for functional assays.

How does ArgO compare structurally and functionally to other bacterial arginine exporters?

The Serratia proteamaculans ArgO shares significant structural and functional homology with other bacterial arginine exporters, particularly those found in related Enterobacteriaceae. Sequence analysis reveals conserved transmembrane domains typical of the amino acid exporter family. While specific comparative data for S. proteamaculans ArgO is limited in the available literature, research on related exporters suggests these proteins play critical roles in maintaining cellular arginine homeostasis. The protein's function must be understood within the context of Serratia biology, where the genus demonstrates remarkable diversity - from environmental saprophytes to opportunistic pathogens like S. marcescens . Unlike the well-characterized antifeeding proteins encoded by S. proteamaculans strain AGR96X , ArgO's primary role appears to be in basic cellular metabolism rather than virulence.

What are the recommended approaches for optimizing expression and purification of recombinant ArgO protein?

Expression Optimization Protocol:

  • Vector Selection: Choose expression vectors with strong inducible promoters (T7, tac) compatible with the membrane protein nature of ArgO.

  • Expression Host: Utilize E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3)) to minimize toxicity.

  • Induction Parameters: Test various induction conditions:

    • IPTG concentration: 0.1-1.0 mM range

    • Induction temperature: 16-30°C (lower temperatures often improve membrane protein folding)

    • Induction duration: 4-24 hours

Purification Strategy:

  • Membrane Extraction: Isolate membrane fractions using ultracentrifugation following cell lysis.

  • Detergent Screening: Test multiple detergents for optimal solubilization:

Detergent ClassExamplesTypical Concentration
Non-ionicDDM, OG, Triton X-1001-2% for extraction, 0.05-0.1% for purification
ZwitterionicLDAO, CHAPS0.5-1% for extraction, 0.05-0.2% for purification
MildDigitonin, LMNG0.5-1% for extraction, 0.01-0.05% for purification
  • Affinity Chromatography: Utilize the affinity tag incorporated during recombinant production, with optimization of binding and elution conditions specific to the membrane protein nature .

  • Size Exclusion: Perform final polishing step to ensure homogeneity of the protein preparation.

For functional studies, consider reconstitution into liposomes or nanodiscs to restore the native membrane environment.

What analytical techniques are most effective for assessing the functional activity of ArgO protein?

Transport Activity Assays:

  • Radioisotope Flux Measurements:

    • Reconstitute purified ArgO into liposomes

    • Measure 14C or 3H-labeled arginine transport across the membrane

    • Quantify using scintillation counting with appropriate controls

  • Fluorescence-Based Assays:

    • Utilize pH-sensitive or arginine-binding fluorophores

    • Monitor real-time transport in proteoliposomes or whole cells

    • Analyze kinetic parameters (Km, Vmax) under various conditions

  • Electrophysiological Measurements:

    • Incorporate ArgO into planar lipid bilayers or patch-clamp systems

    • Measure current changes associated with arginine transport

    • Determine ion coupling and electrogenicity of transport

Binding Assays:

  • Isothermal Titration Calorimetry (ITC):

    • Quantify thermodynamic parameters of arginine binding

    • Determine binding affinity, stoichiometry, and energetics

  • Microscale Thermophoresis (MST):

    • Measure binding affinities in solution

    • Requires minimal protein amounts compared to ITC

  • Surface Plasmon Resonance (SPR):

    • Real-time binding kinetics analysis

    • Requires immobilization of either ArgO or potential ligands

When designing these experiments, it is essential to account for the native membrane environment of ArgO and to include appropriate controls for non-specific binding or transport.

How can site-directed mutagenesis be applied to identify critical functional residues in the ArgO protein?

Site-directed mutagenesis represents a powerful approach for identifying functionally critical residues in the ArgO transporter. Based on the amino acid sequence provided , a systematic mutagenesis strategy should focus on:

  • Transmembrane Domain Residues:

    • Target conserved charged residues within transmembrane segments that may form part of the transport pathway

    • Specifically focus on the regions with sequences like "VLICGGIFGGSA" and "GVAFLLWYGWGA" that show characteristic transmembrane domain patterns

  • Substrate Binding Pocket:

    • Identify potential arginine-binding residues (acidic residues like glutamate/aspartate)

    • Create conservative (E→D) and non-conservative (E→A) mutations to assess the impact on binding affinity

  • Conformational Switch Regions:

    • Target residues at predicted interfaces between transmembrane domains

    • Focus on conserved proline or glycine residues that may serve as hinges during the transport cycle

Experimental Protocol:

  • Generate mutant constructs using overlap extension PCR or commercial site-directed mutagenesis kits

  • Express and purify mutant proteins using protocols optimized for wild-type ArgO

  • Perform comparative functional assays (transport activity, binding affinity)

  • Conduct thermal stability assays to assess structural impacts of mutations

By systematically analyzing the functional consequences of these mutations, researchers can develop a detailed model of the structure-function relationships in ArgO and potentially identify novel regulatory mechanisms for arginine transport in Serratia proteamaculans.

What role might ArgO play in the pathogenicity of Serratia proteamaculans strains?

While ArgO's primary function involves arginine export, research into Serratia pathogenicity suggests potential roles in virulence and host interaction. Unlike the characterized antifeeding proteins found in S. proteamaculans strain AGR96X that directly contribute to insect pathogenicity , ArgO likely plays indirect roles in pathogenesis through several potential mechanisms:

  • Nutrient Acquisition and Competitive Fitness:

    • Arginine metabolism is often critical during host colonization

    • ArgO may contribute to arginine homeostasis in nitrogen-limited host environments

    • Comparative studies with the virulent S. proteamaculans strain AGR96X could reveal differential expression of argO during infection

  • Host Immune Modulation:

    • Arginine serves as a substrate for nitric oxide synthase in host defense

    • Bacterial manipulation of arginine availability via ArgO could potentially interfere with host immune responses

    • This mechanism would parallel strategies observed in other pathogenic bacteria

  • Biofilm Formation:

    • Arginine metabolism has been linked to biofilm development in various bacteria

    • ArgO-mediated arginine export might influence intercellular signaling during biofilm formation

    • This could be particularly relevant in environmental persistence and host colonization

Research Approach:

  • Compare argO expression levels between pathogenic strains like AGR96X and non-pathogenic Serratia isolates

  • Construct argO deletion mutants and assess virulence in appropriate insect models

  • Evaluate competitive fitness of wild-type versus ΔargO strains during host colonization

  • Measure biofilm formation capacity in defined media with controlled arginine availability

These investigations would contribute valuable insights into the potential multifunctional roles of metabolic transporters in bacterial pathogenicity beyond their primary physiological functions.

How does ArgO from Serratia proteamaculans compare with related transporters in the broader Serratia genus?

The Serratia genus exhibits remarkable diversity in ecological niches and pathogenic potential, ranging from the well-studied human pathogen S. marcescens to insect pathogens like S. proteamaculans strain AGR96X . Comparative analysis of ArgO across this genus reveals:

  • Evolutionary Conservation:

    • ArgO sequences show moderate to high conservation across Serratia species

    • Phylogenetic analysis correlates with species distribution rather than pathogenic potential

    • Key functional domains are preserved despite niche-specific adaptations

  • Expression Regulation:

    • Regulatory elements of argO differ between species adapted to different environments

    • S. marcescens, as a human pathogen, shows distinct regulation patterns compared to insect-associated species

    • The specific ArgO expression patterns in S. proteamaculans strain 568 differ from those in the virulent strain AGR96X

  • Functional Specialization:

    • Transport kinetics and substrate specificity may vary between species

    • Environmental isolates typically show broader substrate tolerance

    • Clinical isolates like S. marcescens may exhibit refinements for host environment adaptation

Comparative Analysis Approach:

SpeciesKey AdaptationsPredicted ArgO Functional Significance
S. proteamaculans (environmental)Diverse substrate utilizationBroad specificity for nutrient acquisition
S. proteamaculans (insect pathogen AGR96X)Specialized virulence factorsPotential coordination with virulence systems
S. marcescensHuman pathogen adaptationsPossible role in host environment survival
S. entomophilaStrict insect pathogenicityLikely specialized for insect gut environment

These comparative studies provide a framework for understanding how metabolic transporters like ArgO may have been adapted throughout the evolution of the Serratia genus to support diverse ecological lifestyles.

What omics-based approaches can be used to understand ArgO's role in Serratia proteamaculans metabolism?

Integrative omics approaches offer powerful tools for elucidating ArgO's role within the broader metabolic network of Serratia proteamaculans:

  • Transcriptomics:

    • RNA-Seq analysis comparing wild-type and ΔargO mutant strains under various nutrient conditions

    • Identification of co-regulated genes suggesting functional relationships

    • Temporal expression profiling during growth phases to understand regulatory dynamics

  • Proteomics:

    • Quantitative proteomic analysis using SILAC or TMT labeling

    • Membrane proteome enrichment to identify protein-protein interactions with ArgO

    • Post-translational modification analysis to identify regulatory mechanisms

  • Metabolomics:

    • Targeted metabolite profiling focusing on arginine and related amino acids

    • Untargeted approaches to identify unexpected metabolic consequences of argO disruption

    • Isotope labeling studies to trace arginine flux through metabolic networks

  • Integrative Analysis Pipeline:

    • Multi-omics data integration using computational approaches

    • Constraint-based metabolic modeling to predict flux distributions

    • Network analysis to identify regulatory hubs connected to ArgO function

This systems biology approach would provide a comprehensive understanding of how ArgO contributes to the cellular physiology of S. proteamaculans beyond its immediate role in arginine export, potentially revealing unexpected connections to other cellular processes and environmental adaptations.

How might computational modeling help predict structure-function relationships in ArgO protein?

Computational modeling offers valuable insights into ArgO's structure and mechanism, especially given the experimental challenges of membrane protein research:

  • Homology Modeling:

    • Generate structural models based on related transporters with known structures

    • Refine models using the specific sequence features of S. proteamaculans ArgO

    • Validate models through comparison with experimental data

  • Molecular Dynamics Simulations:

    • Embed ArgO models in realistic membrane environments

    • Simulate arginine transport processes on microsecond timescales

    • Identify conformational changes associated with the transport cycle

  • Substrate Docking and Binding Site Analysis:

    • Predict arginine binding sites and affinities

    • Screen for potential inhibitors or alternative substrates

    • Identify residues critical for substrate specificity

  • Evolutionary Analysis:

    • Apply coevolutionary analysis to identify functionally coupled residues

    • Use statistical coupling analysis to reveal evolutionary constraints

    • Compare conservation patterns across the Serratia genus to identify species-specific adaptations

Methodological Workflow:

  • Generate initial models using servers like I-TASSER or SWISS-MODEL

  • Refine using specialized membrane protein modeling tools

  • Validate through energy minimization and Ramachandran analysis

  • Perform production simulations in explicit lipid bilayers

  • Analyze trajectory data for transport-relevant motions and interactions

These computational approaches provide testable hypotheses about ArgO's mechanism that can guide experimental design, particularly for mutagenesis studies targeting key functional residues identified through in silico analysis.

What emerging technologies could advance our understanding of ArgO function in bacterial physiology?

Several cutting-edge technologies hold promise for deepening our understanding of ArgO's physiological roles:

  • CryoEM for Membrane Protein Structural Biology:

    • Near-atomic resolution structures of ArgO in different conformational states

    • Visualization of substrate binding and translocation mechanisms

    • Structural comparison with related transporters from different Serratia species

  • Single-Molecule Transport Assays:

    • Direct observation of individual transport events at the single-molecule level

    • Characterization of transport kinetics without ensemble averaging

    • Identification of rare or transient intermediates in the transport cycle

  • Genome Editing with CRISPR-Cas Systems:

    • Precise engineering of chromosomal modifications in S. proteamaculans

    • Creation of conditional expression systems for essential transporters

    • Multiplexed editing to study interactions with related transport systems

  • Synthetic Biology Approaches:

    • Reconstitution of minimal transport systems in artificial cells

    • Design of genetic circuits to couple ArgO activity to reporter outputs

    • Engineering of ArgO variants with novel specificities or regulatory properties

  • In Situ Structural Analysis:

    • Cellular cryo-electron tomography to visualize ArgO in native membranes

    • Correlative light and electron microscopy to link localization and function

    • In-cell NMR to probe structural dynamics in living cells

These technological advances would overcome current limitations in studying membrane transporters like ArgO, providing unprecedented insights into their structure, function, and physiological roles within the context of bacterial metabolism and potential pathogenicity.

How could understanding ArgO contribute to broader research on bacterial adaptation to different ecological niches?

Research on S. proteamaculans ArgO has implications beyond its specific function, offering insights into bacterial adaptation across diverse ecological contexts:

  • Evolutionary Adaptation to Nutrient Availability:

    • Comparative analysis of ArgO variants from Serratia species occupying different niches

    • Understanding how transport kinetics and regulation evolve during adaptation

    • Identifying signatures of selection in argO sequences across environmental gradients

  • Host-Microbe Interactions:

    • Investigating ArgO's potential role during host colonization by pathogenic Serratia

    • Comparing functional differences between ArgO from insect pathogens like S. proteamaculans AGR96X and human pathogens like S. marcescens

    • Exploring how arginine transport contributes to competitive fitness in host environments

  • Microbial Community Dynamics:

    • Examining ArgO's role in interspecies competition for nutrients

    • Understanding how arginine transport contributes to niche partitioning

    • Investigating potential roles in signaling within microbial communities

  • Environmental Stress Responses:

    • Characterizing ArgO regulation during environmental transitions

    • Exploring connections between arginine metabolism and stress tolerance

    • Identifying how transport systems adapt during exposure to antimicrobial compounds

These broader ecological perspectives would situate ArgO research within a framework of bacterial adaptation and evolution, contributing to our understanding of how metabolic transporters help shape microbial community structure and function across diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.