Recombinant Serratia proteamaculans ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Spro_0004; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQAN ATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the ATP synthase subunit b (atpF) in Serratia proteamaculans?

ATP synthase subunit b (atpF) is a critical component of the F-type ATPase in Serratia proteamaculans. It forms part of the F0 sector of the ATP synthase complex, which spans the bacterial membrane. The protein consists of 156 amino acids and functions as part of the peripheral stalk that connects the membrane-embedded F0 portion to the catalytic F1 portion of the ATP synthase complex . In bacterial systems, subunit b plays a crucial role in maintaining the structural integrity of the ATP synthase complex while allowing for the rotational catalysis mechanism that drives ATP production through oxidative phosphorylation.

How should researchers store and handle recombinant Serratia proteamaculans ATP synthase subunit b?

For optimal stability and activity, recombinant Serratia proteamaculans ATP synthase subunit b should be stored at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically maintained in a Tris-based buffer with 50% glycerol to prevent freeze-thaw damage . When working with the protein:

  • Avoid repeated freeze-thaw cycles that can lead to protein denaturation

  • Store working aliquots at 4°C for up to one week to minimize degradation

  • Use sterile techniques when handling the protein to prevent contamination

  • Consider adding protease inhibitors if working with the protein in cellular extracts

  • For experimental protocols requiring extended incubation periods, verify protein stability under your specific conditions

What expression systems are most effective for producing recombinant Serratia proteamaculans ATP synthase subunit b?

The selection of an appropriate expression system is critical for successful production of functional recombinant Serratia proteamaculans ATP synthase subunit b. Based on current research methodologies:

Expression SystemAdvantagesChallengesYieldPurification Tags
E. coli BL21(DE3)High yield, fast growthPotential inclusion body formation10-15 mg/LHis-tag, GST
E. coli C43(DE3)Better for membrane proteinsLower yield than BL215-8 mg/LHis-tag, FLAG
Cell-free systemsAvoids toxicity issuesExpensive, complex setup0.5-2 mg/mLHis-tag, Strep-tag
Yeast (P. pastoris)Post-translational modificationsLonger cultivation time3-7 mg/LHis-tag

When expressing bacterial membrane proteins like ATP synthase subunit b:

  • Consider using E. coli C43(DE3) strain, which is engineered for membrane protein expression

  • Express at lower temperatures (16-25°C) to minimize inclusion body formation

  • Optimize induction conditions (IPTG concentration, induction time)

  • Include membrane-mimicking environments during purification (detergents, lipid nanodiscs)

  • Verify protein folding and functionality through activity assays and structural analyses

For researchers studying interactions with other ATP synthase components, co-expression systems may be advantageous to ensure proper complex formation.

What purification strategies yield the highest purity recombinant ATP synthase subunit b?

Purifying recombinant ATP synthase subunit b to high homogeneity requires a multi-step approach:

  • Initial Extraction: Membrane fraction isolation using ultracentrifugation followed by detergent solubilization (typically with n-dodecyl β-D-maltoside or Triton X-100)

  • Affinity Chromatography: His-tag purification using Ni-NTA resin with imidazole gradient elution

  • Ion Exchange Chromatography: Separation based on the protein's isoelectric point

  • Size Exclusion Chromatography: Final polishing step to remove aggregates and achieve >95% purity

For functional studies, researchers should consider:

  • Maintaining the protein in appropriate detergent micelles throughout purification

  • Adding phospholipids to stabilize the protein structure

  • Using protease inhibitors to prevent degradation

  • Performing quality control via SDS-PAGE, western blotting, and mass spectrometry

Yield optimization typically requires balancing between expression conditions and purification efficiency. While higher expression levels may be achieved, they often result in inclusion body formation, necessitating refolding protocols that can compromise final yield and activity.

How can researchers effectively study the interaction between ATP synthase subunit b and other components of the bacterial ATP synthase complex?

Investigating protein-protein interactions involving ATP synthase subunit b requires sophisticated methodological approaches:

  • Crosslinking Studies: Chemical crosslinkers with various spacer lengths can capture transient interactions between subunit b and other components of the ATP synthase complex. MS/MS analysis following crosslinking can identify interaction sites with amino acid resolution.

  • Surface Plasmon Resonance (SPR): To quantitatively measure binding kinetics between subunit b and other purified subunits (particularly subunits a, δ, and α), researchers should:

    • Immobilize one partner (typically subunit b) on a sensor chip

    • Flow the binding partner in various concentrations

    • Analyze association and dissociation constants

    • Consider using detergent-compatible SPR systems for membrane proteins

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label subunit b and potential interaction partners with appropriate fluorophore pairs

    • Measure energy transfer efficiency as an indicator of proximity

    • Use in vitro reconstituted systems or whole bacterial cells with genetically encoded fluorescent proteins

  • Cryo-Electron Microscopy:

    • Recent advances in cryo-EM allow for structural determination of membrane protein complexes

    • Combined with molecular dynamics simulations, this approach can reveal the dynamic interactions between subunit b and other ATP synthase components

  • Bacterial Two-Hybrid Systems:

    • Modified for membrane proteins, these systems can detect interactions in a cellular context

    • Particularly useful for screening multiple potential interaction partners

When designing these experiments, researchers should consider the native membrane environment and how detergents or lipid nanodiscs might affect interaction dynamics.

What role does ATP synthase subunit b play in bacterial energy metabolism during different growth phases?

ATP synthase subunit b's role in bacterial energy metabolism varies across growth phases and environmental conditions. Current research indicates:

Growth PhaseATP Synthase ActivityExpression Level of atpFMetabolic Role
Lag PhaseLowLow-ModerateInitial energy investment
Exponential PhaseHighHighMaximum energy production
Stationary PhaseDecreasedDownregulatedEnergy conservation
Stress ConditionsVariableOften upregulatedAdaptation mechanism

To investigate these dynamics:

  • Use quantitative RT-PCR to measure atpF expression levels under different growth conditions

  • Employ membrane potential-sensitive dyes to assess the correlation between ATP synthase activity and proton motive force maintenance

  • Implement metabolic flux analysis with labeled substrates to track energy production pathways

  • Develop conditional knockout systems to assess the impact of atpF deletion on growth and survival in different environmental conditions

  • Utilize proteomics approaches to measure ATP synthase complex stoichiometry changes across growth phases

In Serratia proteamaculans specifically, researchers should investigate how ATP synthase activity correlates with virulence factor expression, as energy metabolism often coordinates with pathogenic mechanisms .

How do mutations in the atpF gene affect ATP synthase function in Serratia proteamaculans?

Mutations in the atpF gene can significantly impact ATP synthase assembly, stability, and function. Research approaches to investigate these effects include:

  • Site-Directed Mutagenesis: Key regions to target include:

    • N-terminal membrane-anchoring domain (amino acids 1-30)

    • Dimerization interface (middle region)

    • C-terminal domain that interacts with F1 sector

  • Complementation Studies: In atpF knockout strains, express:

    • Wild-type atpF (control)

    • Point mutations

    • Truncation mutants

    • Chimeric proteins with atpF domains from other species

  • Functional Analysis:

    • Measure ATP synthesis rates in membrane vesicles

    • Assess proton translocation efficiency

    • Determine complex assembly via blue native PAGE

    • Evaluate growth rates under different energy sources

The most critical residues for function typically include:

  • Conserved charged residues in the C-terminal domain that facilitate interactions with the δ subunit

  • Hydrophobic residues in the membrane-spanning region

  • Residues involved in dimerization that maintain the structural integrity of the peripheral stalk

Researchers should correlate structural predictions with functional data, as seemingly minor mutations can have significant effects on the complex's rotary mechanism.

How does the structure of Serratia proteamaculans ATP synthase subunit b compare to homologous proteins in other bacterial species?

Comparative analysis of ATP synthase subunit b across bacterial species reveals important evolutionary and functional insights:

To study these comparative aspects:

  • Perform multiple sequence alignments to identify conserved regions that likely play critical functional roles

  • Use homology modeling based on available crystal structures from E. coli or other bacterial species

  • Apply molecular dynamics simulations to predict structural flexibility and stability differences

  • Conduct domain-swapping experiments to determine if functional differences are linked to specific structural elements

  • Investigate species-specific post-translational modifications that might affect function

The most conserved regions typically correspond to:

  • Residues involved in subunit interactions within the ATP synthase complex

  • The membrane-spanning domain architecture

  • The coiled-coil structural motifs that form the peripheral stalk

These comparative studies can provide insights into evolutionary adaptations and potential species-specific targeting strategies.

What methodologies can researchers use to analyze the dynamics of ATP synthase subunit b within the complete ATP synthase complex?

Understanding the dynamic behavior of ATP synthase subunit b requires sophisticated techniques that can capture molecular motion and conformational changes:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Measures solvent accessibility changes during functional cycles

    • Can detect conformational flexibility in different regions of subunit b

    • Protocol must be optimized for membrane proteins in detergent environments

  • Single-Molecule FRET:

    • Allows real-time observation of distance changes between labeled domains

    • Can capture transient states during ATP synthesis

    • Requires careful selection of fluorophore attachment sites to avoid functional interference

  • Molecular Dynamics Simulations:

    • Provides atomic-level insights into protein motion in a lipid bilayer environment

    • Can predict structural changes under different conditions (pH, membrane potential)

    • Should be validated with experimental data

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • For studying flexible regions and local dynamics

    • Challenging for full-length protein but valuable for isolated domains

    • Can detect structural changes upon interaction with other subunits

  • Time-Resolved Electron Microscopy:

    • Captures structural snapshots during the catalytic cycle

    • Requires rapid freezing techniques and sophisticated image processing

Data from these complementary approaches should be integrated to develop a comprehensive model of how subunit b contributes to the rotary mechanism of ATP synthase during catalysis.

How should researchers interpret conflicting results when studying ATP synthase function across different experimental systems?

When faced with contradictory results in ATP synthase research, a systematic approach to reconciliation is essential:

  • Experimental Context Analysis:

    • Compare membrane environments (native membranes vs. reconstituted systems)

    • Assess protein preparation methods (detergents, lipid composition)

    • Evaluate expression systems (bacterial, cell-free)

    • Consider measurement conditions (pH, ion concentrations, temperature)

  • Methodological Cross-Validation:

    MethodStrengthsLimitationsValidation Approach
    In vitro assaysControlled conditionsMay lack cellular factorsComplement with in vivo studies
    Structural studiesHigh resolutionStatic snapshotsCorrelate with dynamic measurements
    Genetic approachesPhysiological relevanceCompensatory mechanismsCombine with biochemical verification
    Computational modelsMechanistic insightsSimplified assumptionsValidate predictions experimentally
  • Statistical Rigor Assessment:

    • Evaluate sample sizes and statistical power

    • Check for appropriate controls

    • Consider biological vs. technical replicates

    • Apply meta-analysis techniques when comparing across studies

  • Alternative Hypothesis Formulation:

    • Develop models that accommodate seemingly contradictory data

    • Consider context-dependent behavior of ATP synthase

    • Test for condition-specific regulatory mechanisms

  • Collaborative Resolution Strategies:

    • Standardize protocols across laboratories

    • Share reagents and constructs

    • Conduct blinded replication studies

Remember that apparent contradictions often reveal deeper biological complexity, such as regulatory mechanisms that may differ between experimental conditions or bacterial species.

How does ATP synthase activity in Serratia proteamaculans correlate with virulence mechanisms?

The relationship between ATP synthase activity and virulence in Serratia proteamaculans involves complex regulatory networks:

  • Energy-Dependent Virulence Factor Production:
    ATP synthase provides the energy required for the synthesis and secretion of virulence factors, including:

    • Serralysin, a metalloprotease that contributes to bacterial invasion

    • Hemolytic toxin ShlA, which forms pores in host cell membranes

    • Chitinolytic enzymes involved in environmental persistence

  • Quorum Sensing System Integration:
    Research has demonstrated that:

    • The LuxI/LuxR-type quorum sensing (QS) system in S. proteamaculans regulates virulence factor expression

    • Inactivation of QS components (SprI and SprR) increases invasive activity through different mechanisms

    • Energy metabolism and QS systems are likely interconnected, with ATP availability potentially modulating signaling pathways

  • Adaptation to Host Environments:

    • ATP synthase activity adjusts to environmental changes during infection

    • Iron limitation, a common host defense mechanism, affects both ATP synthase activity and virulence factor expression in S. proteamaculans

    • Under iron-limited conditions (typical of the human body), wild-type S. proteamaculans shows increased invasion, suggesting metabolic adaptation

To study these correlations:

  • Generate conditional atpF mutants and assess virulence factor production

  • Monitor ATP synthase activity during different stages of infection

  • Investigate transcriptional coordination between atpF and virulence genes

  • Examine metabolic shifts during host cell interaction

What experimental approaches can measure ATP synthase activity in intact Serratia proteamaculans cells?

Measuring ATP synthase activity in living bacterial cells presents unique challenges but offers physiologically relevant insights:

  • Membrane Potential Measurements:

    • Fluorescent probes like DiSC3(5) or JC-1 can monitor membrane potential changes

    • Calibration with ionophores allows quantitative assessment

    • Time-resolved measurements can capture ATP synthase dynamics

  • Intracellular ATP Determination:

    • Luciferase-based ATP assays following rapid cell lysis

    • Genetically encoded ATP sensors for real-time monitoring

    • Combined with inhibitors to distinguish ATP synthase contribution

  • Oxygen Consumption Analysis:

    • High-resolution respirometry with ATP synthase inhibitors

    • Parallel pH monitoring to assess proton translocation

    • Calculate P/O ratios (ATP produced per oxygen consumed)

  • Isotopic Labeling Approaches:

    • 18O-labeling to track phosphate incorporation into ATP

    • 31P-NMR spectroscopy to monitor ATP synthesis rates

    • Metabolic flux analysis with 13C-labeled substrates

  • Genetic Reporter Systems:

    • ATP-responsive promoters driving fluorescent protein expression

    • FRET-based sensors that detect ATP/ADP ratios

    • Can be combined with microfluidics for single-cell analysis

When designing these experiments for S. proteamaculans specifically, researchers should consider:

  • Growth phase-dependent changes in ATP synthase expression

  • Environmental factors that affect energy metabolism

  • Potential interference from other membrane proteins

  • The need for species-specific calibration of probes and sensors

How can CRISPR-Cas9 genome editing be applied to study ATP synthase subunit b function in Serratia proteamaculans?

CRISPR-Cas9 technology offers powerful approaches for investigating ATP synthase subunit b:

  • Precise Genomic Modifications:

    • Single nucleotide changes to examine specific residue functions

    • Domain deletions or insertions to assess structural requirements

    • Promoter modifications to control expression levels

    • Addition of epitope tags for detection without functional disruption

  • Multiplexed Genetic Screens:

    • Library of guide RNAs targeting different regions of atpF

    • Parallel assessment of growth phenotypes under different energy conditions

    • Identification of essential vs. non-essential regions

  • Regulatory Network Analysis:

    • CRISPR interference (CRISPRi) to partially repress atpF expression

    • CRISPRa for upregulation to examine overexpression effects

    • Simultaneous modulation of atpF and other metabolic genes to map genetic interactions

  • In situ Tagging Strategies:

    • Direct fusion of fluorescent proteins or affinity tags to atpF

    • Creation of split-protein complementation systems to study interactions

    • Introduction of specific protease sites for controlled degradation

  • Implementation Protocol Considerations:

    • Optimize transformation efficiency for Serratia proteamaculans

    • Select appropriate Cas9 variants (high-fidelity or nickase versions)

    • Design repair templates that maximize homologous recombination

    • Implement counterselection strategies for marker-free editing

These approaches allow unprecedented precision in manipulating ATP synthase components while maintaining chromosomal context and native regulation.

What are the most promising structural biology techniques for resolving ATP synthase subunit b conformation in different functional states?

Recent advances in structural biology offer new opportunities to capture ATP synthase subunit b in various conformational states:

  • Cryo-Electron Tomography:

    • Visualizes ATP synthase in its native membrane environment

    • Can capture different conformational states during the catalytic cycle

    • Combined with subtomogram averaging for improved resolution

    • Particularly valuable for examining supramolecular organization of ATP synthase complexes

  • Integrative Structural Modeling:

    • Combines data from multiple experimental techniques:

      • X-ray crystallography of individual domains

      • Cryo-EM of the complete complex

      • Crosslinking mass spectrometry for interface mapping

      • SAXS for solution structure validation

    • Computational integration to generate comprehensive structural models

  • Time-Resolved Structural Methods:

    • Temperature-jump experiments coupled with rapid freezing

    • Mixing-spraying approaches for capturing short-lived states

    • Pulsed electron paramagnetic resonance for measuring distance changes

  • Microcrystal Electron Diffraction (MicroED):

    • Applicable to small crystals of membrane protein components

    • Can achieve high resolution with minimal material

    • Potentially useful for difficult-to-crystallize domains of subunit b

  • Native Mass Spectrometry:

    • Preserves non-covalent interactions during analysis

    • Can detect different oligomeric states and ligand binding

    • Reveals subunit stoichiometry and assembly intermediates

Implementation challenges for S. proteamaculans ATP synthase include:

  • Maintaining protein stability during sample preparation

  • Distinguishing between functional states and preparation artifacts

  • Resolving conformational heterogeneity

  • Integrating structural data across different resolution scales

What are the common challenges in expressing and purifying functional recombinant ATP synthase subunit b, and how can researchers overcome them?

Researchers frequently encounter several obstacles when working with recombinant ATP synthase subunit b:

ChallengeCauseSolution Strategies
Low expression yieldToxicity to host cellsUse tight expression control; C41/C43 E. coli strains; lower induction temperature
Inclusion body formationImproper foldingCo-express with chaperones; use fusion tags (SUMO, MBP); optimize induction conditions
Poor solubilityHydrophobic regionsInclude appropriate detergents; use lipid nanodiscs; consider cell-free expression
Proteolytic degradationExposed cleavage sitesAdd protease inhibitors; remove flexible linkers; optimize purification speed
Loss of functionDenaturation during purificationMaintain native-like environment; validate with functional assays at each step

Specific methodology refinements:

  • For Membrane Integration Issues:

    • Add phospholipids during purification to stabilize membrane domains

    • Use mild detergents like DDM or LMNG rather than harsh ones like SDS

    • Consider amphipol encapsulation for long-term stability

  • For Complex Assembly Challenges:

    • Co-express with interacting partners (especially subunit a)

    • Implement stepwise reconstitution protocols

    • Validate proper folding with circular dichroism spectroscopy

  • For Functional Verification:

    • Develop miniaturized activity assays for screening purification conditions

    • Implement thermostability assays to identify stabilizing additives

    • Use native gel electrophoresis to confirm oligomeric state

  • For Scale-up Considerations:

    • Optimize cell lysis methods to maximize recovery from membranes

    • Develop tangential flow filtration protocols for efficient concentration

    • Establish quality control metrics that correlate with functional activity

Each of these approaches should be systematically evaluated and optimized for the specific properties of S. proteamaculans ATP synthase subunit b.

How can researchers effectively analyze and interpret ATP synthase functional data across different experimental conditions?

Robust data analysis strategies are essential for meaningful interpretation of ATP synthase experiments:

  • Normalization Approaches:

    • Normalize to protein concentration for cross-sample comparison

    • Use internal standards to account for instrument variability

    • Implement sample-specific calibration curves for quantitative measurements

    • Consider normalization to membrane surface area for whole-cell studies

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests based on data distribution

    • Use power analysis to determine required sample sizes

    • Implement mixed-effects models for nested experimental designs

    • Employ Bayesian approaches for integrating prior knowledge with new data

  • Integrated Data Visualization:

    • Develop custom visualizations that capture multiple parameters

    • Create interactive dashboards for exploring complex datasets

    • Use dimension reduction techniques for multivariate data

    • Implement time-series visualizations for dynamic processes

  • Meta-analysis Considerations:

    • Standardize reporting of experimental conditions

    • Develop consistent metrics across studies

    • Weight findings based on methodological rigor

    • Identify and account for systematic biases

  • Predictive Modeling Applications:

    • Develop structure-function relationship models

    • Create predictive models for optimal expression conditions

    • Implement machine learning approaches for pattern recognition in complex datasets

    • Use systems biology models to integrate ATP synthase function with broader metabolic networks

When comparing results across different growth conditions or experimental setups, researchers should:

  • Maintain consistent control experiments

  • Document all variables that might affect outcomes

  • Consider interaction effects between variables

  • Establish clear criteria for biological vs. statistical significance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.