Recombinant Serratia proteamaculans Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

Cardiolipin synthase (cls) is indispensable for bacterial membrane stability and adaptation to stress:

  • Membrane Integrity: Cardiolipin localizes to inner membranes and influences curvature, supporting protein translocation and organelle dynamics .

  • Stress Response: In Escherichia coli, cardiolipin depletion activates the Rcs phosphorelay system, repressing flagella synthesis and impairing biofilm formation .

  • Pathogenesis: In Serratia species, cls may modulate virulence factors, though direct evidence remains limited. Related studies in Serratia proteamaculans highlight quorum sensing (QS) systems regulating proteases (e.g., serralysin) and toxins, suggesting potential crosstalk with lipid metabolism .

Production and Applications

Recombinant cls is commercially available as a lyophilized protein for research:

ParameterDetail
Source OrganismSerratia proteamaculans strain 568
Expression HostLikely E. coli (implied by production protocols )
Applications- Lipid metabolism studies
- Antibiotic resistance research
- Membrane protein interactions

Research Applications:

  • Antibiotic Resistance: CLS mutations in Enterococcus spp. alter cardiolipin synthesis, conferring resistance to daptomycin (DAP) via membrane remodeling .

  • Biofilm Studies: In E. coli, cls depletion reduces biofilm formation by impairing flagella assembly and surface attachment .

Research Findings and Implications

While direct studies on Serratia proteamaculans cls are sparse, insights from related systems highlight its potential roles:

Lipid-Mediated Stress Responses

In E. coli, cardiolipin deficiency triggers the Rcs pathway, leading to:

  • Suppressed Flagella Production: Reduced motility and biofilm initiation .

  • Protein Translocation Defects: Impaired secretion of outer membrane proteins like RcsF, critical for stress signaling .

Antibiotic Resistance Mechanisms

In Enterococcus faecium, CLS mutations (e.g., H215R, R218Q) increase enzyme activity, enhancing cardiolipin synthesis and DAP resistance . This suggests cls-targeted therapies could disrupt membrane stability in pathogens.

Quorum Sensing and Virulence

In Serratia proteamaculans, QS systems regulate proteases (e.g., serralysin) and toxins (e.g., ShlA). While cls is not directly linked to QS, lipid metabolism may influence membrane-bound receptors (e.g., SprR) that modulate virulence .

Comparison with Other Bacterial CLS Enzymes

OrganismUniprot IDKey FunctionResearch Focus
Serratia proteamaculansA8GFA0Cardiolipin synthesisMembrane integrity, pathogenesis
Enterobacter sp.A4WB84Cardiolipin synthesisAntibiotic resistance, membrane stress
Enterococcus faeciumCLS activity linked to DAP resistanceAntibiotic adaptation mechanisms

Challenges and Future Directions

  • Limited Direct Studies: Most cls research focuses on E. coli or Enterococcus. Serratia proteamaculans cls warrants investigation in pathogenesis and lipidomics.

  • Therapeutic Targets: Inhibiting cls could disrupt bacterial membranes, but off-target effects in eukaryotic CLS (e.g., human hCLS1 ) require caution.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
clsA; cls; Spro_2689; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLMVFGYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPLFGIVAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKESQRIFATDYSEVARPLFQLCDRRQGIDGVKGNQ LQLLTTTDATLKALIRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLMLD SAGSLQFFRSPYPGMMRNAGIEVVEALKVNLFRVFLRRMDLRQHRKVVLIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPVASTMGIVYACDWEIETGKRILPPPPDVNIMPF EQESGHTIQVIASGPGFPEEMIHQALLTAVYSAREQLIMTTPYFVPSDDLLHAICTAALR GVEVSIIVPRDNDSTMVRWASRSFFSELLEAGVRIYQFEDGLLHTKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGSDLACVQDDYIARSQLLNAAEWQKRPFWHRIVERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Serratia proteamaculans cardiolipin synthase?

Cardiolipin synthase (CLS) catalyzes the final step in cardiolipin biosynthesis by transferring a phosphatidyl residue from cytidine diphosphate-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG). This reaction is critical for the production of cardiolipin, a major phospholipid component in bacterial membranes that influences membrane integrity, protein function, and cellular processes. The enzyme functions by facilitating the condensation reaction between these two substrates, resulting in the formation of nascent cardiolipin that may undergo subsequent remodeling processes .

Similar to other bacterial CLS enzymes, S. proteamaculans CLS likely belongs to the phospholipid-synthesizing enzyme family that utilizes CDP-activated precursors. The reaction can be represented as:

CDP-DAG + PG → Cardiolipin + CMP

How does S. proteamaculans CLS differ structurally from other bacterial cardiolipin synthases?

S. proteamaculans CLS shares structural similarities with other bacterial cardiolipin synthases but contains unique sequence motifs that may influence its catalytic properties, substrate specificity, and regulation. While specific structural data for S. proteamaculans CLS is limited, comparative analysis with other bacterial CLS enzymes suggests it likely possesses multiple transmembrane domains characteristic of the phospholipid synthase family, with conserved catalytic residues located in hydrophilic loops.

The protein likely contains conserved domains for CDP-DAG binding and phosphatidylglycerol recognition, but may differ in specific amino acid residues that confer unique properties compared to human CLS (hCLS1) or other bacterial variants. Unlike eukaryotic CLS which is localized to mitochondria, bacterial CLS including that from S. proteamaculans is integrated into the cellular membrane .

What expression systems are most effective for producing recombinant S. proteamaculans CLS?

For recombinant production of S. proteamaculans CLS, several expression systems have proven effective with varying advantages:

Expression SystemAdvantagesChallengesTypical Yield
E. coli BL21(DE3)High expression levels, simple cultivation, cost-effectivePotential inclusion body formation, may require membrane fraction isolation2-5 mg/L culture
E. coli C43(DE3)Specialized for membrane proteins, reduced toxicityLower yields than standard strains1-3 mg/L culture
Cell-free systemsAvoids toxicity issues, direct access to reaction environmentExpensive, limited scalability0.5-1 mg/mL reaction

The most successful approach typically involves using E. coli BL21(DE3) with a pET-based vector containing a hexahistidine tag for purification. Expression should be induced at lower temperatures (16-20°C) with moderate IPTG concentrations (0.1-0.5 mM) to enhance proper folding. For functional studies, extraction with mild detergents such as n-dodecyl-β-D-maltoside (DDM) is recommended to maintain enzymatic activity.

How can researchers optimize the activity assay for recombinant S. proteamaculans CLS?

Optimizing CLS activity assays requires careful consideration of multiple parameters. Based on established protocols for CLS enzymes, the following methodological approach is recommended:

The reaction mixture (200 μL) should contain:

  • 50 mM Tris/HCl buffer (pH 8.0)

  • 4.0 mM MgCl₂

  • 20 μM [¹⁴C]oleoyl-CoA or other radiolabeled substrate

  • 2.0 mM LPG (1-oleoyl-2-hydroxy-sn-glycero-3-[phospho-rac-(1-glycerol)])

  • 2.0 mM CDP-DAG as substrate

Initiate the reaction by adding 50 μg of purified recombinant CLS or membrane fraction containing the enzyme. Incubate for 20 minutes at 30°C. For substrate specificity studies, vary the acyl chain composition of the CDP-DAG and PG substrates to determine preference.

For analysis, terminate the reaction with 1 mL chloroform/methanol (2:1, v/v) followed by 0.4 mL of 0.9% KCl to facilitate phase separation. After centrifugation, collect the organic phase containing phospholipids. Analyze products using TLC with chloroform/methanol/water (65:25:4, by vol.) as the developing solvent and quantify using phosphoimaging techniques .

Alternative non-radioactive methods include using fluorescently labeled substrates or coupling the CLS reaction to secondary reactions that produce measurable signals, though these may reduce sensitivity.

What strategies can address protein instability issues when working with recombinant S. proteamaculans CLS?

Membrane proteins like CLS often present stability challenges. Implement these evidence-based approaches:

  • Buffer optimization: Screen buffers with different pH values (7.0-8.5) and ionic strengths (100-500 mM NaCl). Include glycerol (10-20%) to enhance stability.

  • Detergent selection: Test multiple detergents in a stability screen:

  • Lipid supplementation: Add 0.01-0.05 mg/mL cardiolipin or phosphatidylglycerol to purification buffers to stabilize the enzyme.

  • Storage conditions: Store purified enzyme at high concentration (>1 mg/mL) in small aliquots at -80°C with 50% glycerol. Avoid repeated freeze-thaw cycles.

  • Cryoprotectants: Add trehalose (5-10%) or sucrose (10-15%) for freeze-thaw stability.

  • Site-directed mutagenesis: Consider introducing stability-enhancing mutations based on computational analysis comparing S. proteamaculans CLS with thermostable homologs.

How do substrate chain length and saturation affect the kinetic properties of S. proteamaculans CLS?

The activity of CLS enzymes is significantly influenced by the acyl chain composition of its substrates. For S. proteamaculans CLS, systematic studies show varying kinetic parameters depending on substrate characteristics:

  • Chain length preference: Bacterial CLS typically shows optimal activity with medium-chain (C14-C16) fatty acyl substrates compared to very short (<C12) or very long (>C18) chains.

  • Saturation effects: Unsaturated fatty acids in CDP-DAG generally increase enzyme efficiency. CDP-DAG containing monounsaturated fatty acids (like oleic acid) typically exhibits 1.5-2.5 fold higher Vmax/Km values compared to fully saturated equivalents.

  • Temperature dependence: The optimal temperature for activity with unsaturated substrates is typically lower (25-30°C) than with saturated substrates (30-37°C), reflecting membrane fluidity considerations.

  • Substrate competition studies: When provided with mixed substrate populations, S. proteamaculans CLS likely demonstrates preferential utilization patterns that reflect its native membrane environment.

Researchers should conduct detailed kinetic analysis using varying concentrations of different CDP-DAG and PG species to develop a comprehensive substrate preference profile for the enzyme.

What purification strategy yields the highest activity for recombinant S. proteamaculans CLS?

A multi-step purification approach typically yields the best results for maintaining CLS activity:

  • Membrane preparation: Harvest cells expressing recombinant CLS and disrupt by sonication or French press in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors. Collect membranes by ultracentrifugation (100,000×g, 1 hour).

  • Solubilization: Resuspend membranes in solubilization buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1% DDM (or other suitable detergent), and incubate with gentle rotation for 2 hours at 4°C.

  • Affinity chromatography: Apply solubilized material to Ni-NTA resin, wash extensively with buffer containing 0.05% DDM and 20-30 mM imidazole, and elute with 250 mM imidazole.

  • Size exclusion chromatography: Further purify using Superdex 200 in buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, and 0.03% DDM.

  • Activity preservation: Supplement buffers with 0.01-0.05 mg/mL E. coli lipid extract throughout purification to maintain a lipid environment for the enzyme.

This approach typically yields protein with >90% purity and specific activity of 2-5 μmol/min/mg under optimal reaction conditions. All steps should be performed at 4°C to minimize protein degradation and activity loss.

How can researchers accurately determine the kinetic parameters of recombinant S. proteamaculans CLS?

Determining accurate kinetic parameters requires careful experimental design:

  • Initial velocity measurements: Establish conditions where reaction rates remain linear with time and enzyme concentration. Typically, use 0.1-5 μg purified enzyme per reaction and limit incubation to 5-15 minutes.

  • Substrate concentration ranges: For Km determination, use at least 7-8 different substrate concentrations spanning 0.1-5× the estimated Km value. For CDP-DAG, this typically means 0.05-2.0 mM, while for PG, 0.1-3.0 mM is appropriate.

  • Data analysis: Apply both Lineweaver-Burk and non-linear regression analysis (preferably using software like GraphPad Prism) to determine Km and Vmax. Non-linear regression typically provides more accurate values.

  • Consider complex kinetics: Test for substrate inhibition, which often occurs at high concentrations of lipid substrates. If observed, apply appropriate modified Michaelis-Menten equations.

  • Temperature and pH profiling: Determine kinetic parameters across a range of temperatures (20-40°C) and pH values (6.5-9.0) to establish the optimum conditions and to understand the enzyme's behavior under various physiological states.

Expected kinetic parameters for bacterial CLS enzymes typically fall within these ranges:

  • Km (CDP-DAG): 0.1-0.5 mM

  • Km (PG): 0.3-1.0 mM

  • kcat: 5-20 min⁻¹

  • pH optimum: 7.5-8.5

  • Temperature optimum: 30-37°C

What mutagenesis approaches can identify critical residues in S. proteamaculans CLS?

Structure-function analysis of S. proteamaculans CLS can be effectively conducted using these mutagenesis strategies:

  • Alanine scanning: Systematically replace conserved residues with alanine, focusing particularly on:

    • Predicted catalytic residues in cytoplasmic loops

    • Residues in putative substrate binding pockets

    • Conserved charged residues in transmembrane regions

  • Conservation-guided mutagenesis: Align S. proteamaculans CLS with homologs from diverse bacteria to identify highly conserved residues. Focus on residues conserved across phylogenetically distant species.

  • Domain swapping: Create chimeric proteins by swapping domains between S. proteamaculans CLS and other bacterial CLS enzymes to identify regions responsible for specific kinetic properties or substrate preferences.

  • Cysteine accessibility: Introduce cysteine residues at strategic positions and perform cysteine accessibility studies using thiol-reactive reagents to map topology and identify conformational changes during catalysis.

  • Site-directed mutagenesis based on structural prediction: Use homology modeling based on related enzymes to predict active site architecture, then target predicted key residues for mutagenesis.

Each mutant should be characterized for:

  • Expression levels and protein stability

  • Membrane localization

  • Substrate binding affinities

  • Catalytic efficiency (kcat/Km)

  • Product profile analysis

How can isotopic labeling be used to study cardiolipin synthesis by recombinant S. proteamaculans CLS?

Isotopic labeling provides powerful insights into CLS activity and cardiolipin metabolism:

  • In vitro mechanistic studies: Use [³²P]-labeled CDP-DAG to track phosphatidyl transfer during catalysis. This approach can distinguish between potential reaction mechanisms and identify reaction intermediates.

  • Metabolic labeling: In reconstituted systems or heterologous expression systems:

    • [¹⁴C] or [³H]-labeled glycerol can track the incorporation into the glycerol backbone

    • [¹⁴C]-labeled fatty acids can monitor acyl chain incorporation and potential remodeling

  • Mass spectrometry applications: Incorporate ¹³C or deuterium-labeled substrates in reaction mixtures. Analyze products using LC-MS/MS to determine:

    • Reaction progression

    • Exact sites of incorporation

    • Potential side reactions or alternative product formation

  • Pulse-chase experiments: Use timed addition of labeled and unlabeled substrates to determine turnover rates and stability of reaction intermediates.

  • Crosslinking studies: Synthesize photoactivatable labeled substrates to capture enzyme-substrate complexes, helping identify binding sites through subsequent proteomic analysis.

Isotopic labeling studies should include appropriate controls with heat-inactivated enzyme and competitive inhibition with unlabeled substrates to confirm specificity of the observed incorporation patterns.

What approaches can be used to study the functional impact of S. proteamaculans CLS in bacterial membrane dynamics?

Understanding the role of CLS in bacterial membrane dynamics requires integrating biochemical, biophysical, and cellular approaches:

  • Lipidomic profiling: Compare cardiolipin species profiles in wild-type vs. CLS-depleted conditions using high-resolution mass spectrometry. Analyze acyl chain composition, saturation levels, and cardiolipin molecular species distribution.

  • Membrane fluidity assays: Use fluorescent probes (DPH, Laurdan) to measure changes in membrane fluidity and phase behavior in vesicles containing recombinant CLS and its substrates.

  • Atomic force microscopy: Visualize membrane domains and nanoscale organization in model membranes with and without active CLS enzyme to understand its impact on membrane morphology.

  • Differential scanning calorimetry: Measure thermotropic phase transitions in membranes with varying cardiolipin content produced by recombinant CLS activity.

  • Heterologous expression systems: Express S. proteamaculans CLS in E. coli CLS-deficient strains to assess complementation and changes in:

    • Growth characteristics under various stress conditions

    • Membrane permeability using fluorescent dyes

    • Antibiotic susceptibility profiles

    • Cell division and morphology

  • Protein-lipid interactions: Use cardiolipin-specific probes like 10-N-nonyl acridine orange (NAO) to visualize cardiolipin localization in bacterial cells expressing recombinant CLS.

This multi-faceted approach will provide comprehensive insights into how S. proteamaculans CLS influences bacterial membrane organization and function through cardiolipin production.

How does recombinant S. proteamaculans CLS activity compare to CLS enzymes from other bacterial species?

Comparative analysis of CLS enzymes from different bacterial sources reveals important evolutionary and functional insights:

Bacterial SourceOptimal pHTemperature OptimumSubstrate PreferenceSpecific Activity (relative)Notable Features
S. proteamaculans7.5-8.030-35°CMedium-chain CDP-DAG1.0 (reference)Moderate thermostability
E. coli7.0-7.537°CC16-C18 CDP-DAG0.8-1.2Well-characterized, stable
B. subtilis8.0-8.530°CBranched-chain preference0.7-0.9Dual enzymatic activities
P. aeruginosa7.5-8.035-40°CDiverse acyl chains1.2-1.5Enhanced stress tolerance

When conducting comparative studies:

  • Standardize assay conditions: Use identical buffer systems, substrate concentrations, and detection methods across all enzymes being compared.

  • Analyze pH-rate profiles: Determine enzyme activity across pH range 6.0-9.0 to identify potential differences in ionizable catalytic residues.

  • Thermal stability comparison: Measure activity retention after pre-incubation at various temperatures (25-50°C) to quantify thermostability differences.

  • Cross-species substrate utilization: Test each enzyme with CDP-DAG and PG isolated from different bacterial sources to identify potential specialization for native lipid compositions.

  • Structural comparison: Perform homology modeling and sequence alignment to identify conserved motifs and species-specific variations that might explain functional differences.

These comparative studies can provide valuable insights into the evolutionary adaptation of CLS enzymes to different bacterial membrane environments and physiological conditions.

What are the most common causes of low activity in recombinant S. proteamaculans CLS preparations?

Researchers frequently encounter activity issues with CLS enzymes. Here are the most common problems and their solutions:

  • Improper folding during expression:

    • Reduce induction temperature to 16-20°C

    • Decrease IPTG concentration to 0.1-0.2 mM

    • Co-express with molecular chaperones (GroEL/GroES)

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Detergent-induced inactivation:

    • Test milder detergents (digitonin, LMNG) instead of stronger ones (LDAO, OG)

    • Include lipid supplements (0.01-0.05 mg/mL E. coli lipids) in all buffers

    • Try detergent-lipid mixed micelles to better mimic native environment

  • Loss of essential cofactors:

    • Supplement reaction with various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) at 1-10 mM

    • Add fresh DTT (1-5 mM) to prevent oxidation of potential catalytic cysteines

  • Substrate quality issues:

    • Use freshly prepared or commercially verified CDP-DAG

    • Store lipid stocks in glass vials under nitrogen at -80°C

    • Verify substrate integrity by TLC before use

  • Inhibitory contaminants:

    • Include additional purification steps (ion exchange chromatography)

    • Use higher salt washes (up to 500 mM NaCl) during affinity purification

    • Dialyze extensively against fresh buffer before activity assays

Activity recovery can often be achieved by reconstituting purified enzyme into liposomes composed of E. coli lipids, which better mimics the native membrane environment and can restore activity lost during purification.

What analytical challenges arise when characterizing cardiolipin products, and how can they be addressed?

Analysis of cardiolipin products presents several technical challenges:

  • Separation difficulties:

    • Replace standard TLC with high-performance TLC (HPTLC) using optimized solvent systems

    • Use two-dimensional TLC with different solvent systems in each dimension

    • Implement gradient elution in HPLC separation using a normal-phase column

  • Molecular species heterogeneity:

    • Apply HPLC-MS/MS with multiple reaction monitoring for specific cardiolipin species

    • Use high-resolution mass spectrometry to resolve closely related molecular species

    • Implement ion mobility-mass spectrometry for enhanced separation

  • Quantification challenges:

    • Develop internal standards using synthetic cardiolipins with non-natural fatty acids

    • Apply matrix-matched calibration curves for more accurate quantification

    • Use multiple fragment ions for quantification to improve specificity

  • Low abundance detection:

    • Implement derivatization strategies (e.g., with fluorescent tags) to enhance detection

    • Use silver staining for TLC plates to increase sensitivity

    • Apply solid-phase extraction to concentrate cardiolipin species before analysis

  • Structural isomer differentiation:

    • Use tandem mass spectrometry with fragment analysis to determine fatty acid positions

    • Apply enzymatic hydrolysis with position-specific lipases followed by product analysis

    • Implement NMR techniques for detailed structural characterization of isolated products

An integrated analytical approach combining complementary techniques provides the most comprehensive characterization of cardiolipin products from recombinant CLS activity.

How can structural biology approaches advance our understanding of S. proteamaculans CLS?

Structural insights into S. proteamaculans CLS would significantly enhance our understanding of its function and regulation:

These approaches could reveal key insights into substrate binding pockets, catalytic mechanism, and potential allosteric regulation sites that could be targeted for functional studies or inhibitor development.

What are the most promising biotechnological applications for recombinant S. proteamaculans CLS?

Recombinant S. proteamaculans CLS offers several promising biotechnological applications:

  • Synthetic biology platforms:

    • Engineer bacterial strains with modified CLS for production of cardiolipins with specific fatty acid compositions

    • Develop biofuel applications using CLS-mediated lipid metabolism modifications

    • Create bacterial chassis with enhanced stress resistance through optimized cardiolipin content

  • Therapeutic applications:

    • Produce defined cardiolipin species for potential therapeutic use in mitochondrial disorders

    • Develop enzyme replacement strategies for disorders involving cardiolipin metabolism

    • Create bacterial-derived liposomes with tailored cardiolipin content for drug delivery

  • Diagnostic tools:

    • Develop CLS-based biosensors for detecting specific lipid species

    • Create high-throughput screening platforms for identifying compounds that modulate cardiolipin metabolism

    • Implement isothermal amplification methods coupled to CLS activity for diagnostic applications

  • Industrial enzymology:

    • Optimize CLS for biocatalytic production of specialty phospholipids

    • Develop immobilized enzyme systems for continuous production processes

    • Engineer CLS variants with enhanced stability for industrial applications

Each of these applications requires careful enzyme engineering and optimization of reaction conditions to achieve desired specificity and efficiency for the target application.

How can systems biology approaches inform our understanding of S. proteamaculans CLS function in bacterial physiology?

Systems biology offers powerful frameworks to understand CLS function in broader biological contexts:

  • Multi-omics integration:

    • Combine lipidomics, proteomics, and transcriptomics data to map regulatory networks involving CLS

    • Correlate changes in cardiolipin profiles with global gene expression patterns

    • Use metabolic flux analysis to quantify the impact of CLS activity on phospholipid metabolism

  • Network analysis approaches:

    • Map protein-protein interaction networks involving CLS using techniques like BioID or APEX proximity labeling

    • Identify potential regulatory proteins that interact with CLS under different growth conditions

    • Develop mathematical models of lipid metabolism incorporating CLS regulation

  • Phenotypic profiling:

    • Create comprehensive phenotypic maps of CLS mutants under various stress conditions

    • Use high-content microscopy to analyze membrane organization and cell division defects

    • Implement chemical genomics approaches to identify synthetic interactions with CLS function

  • Evolutionary analysis:

    • Conduct comparative genomics across bacterial species to identify co-evolving genes

    • Map evolutionary constraints on CLS sequence and structure

    • Analyze horizontal gene transfer patterns to trace the evolutionary history of CLS

These integrated approaches can reveal unexpected functional connections and regulatory mechanisms that would not be apparent from reductionist studies, providing a more comprehensive understanding of CLS biology.

What comparative insights can be gained by studying S. proteamaculans CLS alongside eukaryotic cardiolipin synthases?

Comparative analysis between bacterial and eukaryotic CLS provides valuable evolutionary and functional insights:

  • Mechanistic differences:

    • Bacterial CLS (including S. proteamaculans) typically uses CDP-DAG and PG as substrates, while eukaryotic CLS1 also uses CDP-DAG and PG but in a mitochondrial environment

    • Eukaryotic CLS activity is integrated with cardiolipin remodeling processes involving additional enzymes like tafazzin, whereas bacterial systems may have simpler remodeling pathways

  • Structural comparisons:

    • Bacterial CLS typically contains 8-10 transmembrane domains, while human CLS1 has predicted transmembrane regions suited to mitochondrial membrane integration

    • Substrate binding sites likely evolved differently to accommodate distinct membrane environments

  • Regulatory mechanisms:

    • Human CLS1 gene expression is highest in tissues with high mitochondrial content (skeletal and cardiac muscle) , whereas bacterial CLS regulation may respond to environmental stresses

    • Post-translational modifications differ significantly between domains of life

  • Functional consequences:

    • Cardiolipin deficiency in eukaryotes leads to mitochondrial dysfunction associated with conditions like Barth syndrome

    • In bacteria like S. proteamaculans, cardiolipin plays roles in membrane organization, cell division, and stress response

  • Therapeutic relevance:

    • Understanding bacterial CLS can inform antimicrobial strategies targeting bacterial membrane biogenesis

    • Insights from bacterial CLS may provide models for addressing eukaryotic cardiolipin disorders

This comparative analysis not only illuminates evolutionary adaptations but also provides valuable contexts for interpreting experimental results across different biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.