Recombinant Serratia proteamaculans Fumarate reductase subunit C (frdC)

What is Fumarate reductase subunit C and what is its role in microbial metabolism?

Fumarate reductase subunit C (frdC) is one of the critical components of the fumarate reductase complex, which plays an essential role in anaerobic respiration in many bacteria. This enzyme catalyzes the conversion of fumarate to succinate through the reaction: succinate + acceptor ⟺ fumarate + reduced acceptor . The frdC subunit specifically functions as an integral membrane anchor protein in the quinol-fumarate reductase variant (EC 1.3.5.4), which is membrane-bound and contains 3-4 subunits . In Serratia proteamaculans, frdC is a hydrophobic protein of approximately 15 kDa . This protein is particularly significant because it enables microorganisms to use fumarate as a terminal electron acceptor during anaerobic growth, providing an alternative to oxygen in the electron transport chain, thereby facilitating energy conservation in oxygen-limited environments.

How does Serratia proteamaculans frdC differ from frdC in other bacterial species?

The frdC protein from Serratia proteamaculans (strain 568) has unique structural and functional characteristics compared to other bacterial species. While its core function remains consistent across species, the S. proteamaculans frdC (UniProt accession: A8G8T5) has a specific amino acid sequence that distinguishes it: MTTQRKPYVRTMTPTWWQKLGFYRFYmLREGTSVPAVWFSIVLIYGVFALKGGVDSWAGFVGFLQNPLVLLINFVALLAALLHTKTWFDLAPKAANIVVNSEKMGPGPIVKTLWAVTVVASVVILAVALV . In comparison, the Yersinia pestis frdC (UniProt ID: Q8ZIX7) has a slightly different sequence: MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIYGVFALKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKMGPEPMIKALWVVTVVASAIILAVALL . These sequence variations can impact protein folding, membrane integration, and potentially the efficiency of electron transfer in the fumarate reductase complex. Researchers should consider these species-specific differences when designing experiments or interpreting results across bacterial models.

What is the expression region and protein structure of Serratia proteamaculans frdC?

The Serratia proteamaculans frdC protein is expressed across the region spanning amino acid positions 1-130, representing the full-length protein . This hydrophobic membrane protein contains multiple transmembrane domains that anchor the fumarate reductase complex to the bacterial cell membrane. The protein's structure is characterized by alpha-helical segments that traverse the membrane, with the hydrophobic amino acids facilitating membrane integration. When examining the amino acid sequence, researchers can identify these transmembrane domains through hydropathy analysis. The ordered locus name for this gene in S. proteamaculans is Spro_0417 . Understanding this structure is critical for experimental design, particularly when engineering recombinant versions with tags that might alter membrane integration or when developing antibodies against specific epitopes of the protein.

What are the optimal storage conditions for recombinant frdC protein?

The optimal storage conditions for recombinant Serratia proteamaculans frdC protein involve multiple considerations to maintain structural integrity and functional activity. For long-term storage, the protein should be kept at -20°C or preferably -80°C in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . For recombinant frdC with His-tags (similar to the Yersinia pestis version), a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has proven effective . It is strongly recommended to avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity and activity . For working purposes, aliquots should be stored at 4°C for no longer than one week . When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol (typically to a final concentration of 50%) for subsequent storage . Researchers should centrifuge vials briefly before opening to ensure content recovery and consider making multiple small aliquots during initial preparation to minimize freeze-thaw damage.

How should researchers design experiments to evaluate the functionality of recombinant frdC?

Designing robust experiments to evaluate recombinant frdC functionality requires a multifaceted approach that addresses both structural integrity and enzymatic activity. Researchers should implement a systematic protocol that begins with confirming proper protein expression and purification through SDS-PAGE analysis (targeting >90% purity) . For functional assessment, enzyme activity assays should measure the conversion of fumarate to succinate using spectrophotometric methods that track the oxidation of reduced acceptor molecules.

The experimental design should include:

• Protein Validation: Confirm protein identity using western blotting with anti-frdC or anti-tag antibodies.

• Membrane Integration: Assess proper membrane incorporation using membrane fractionation techniques.

• Enzymatic Activity: Measure fumarate reduction rates under anaerobic conditions with appropriate electron donors.

• Complex Formation: Evaluate interaction with other fumarate reductase subunits through co-immunoprecipitation.

• Environmental Variables: Test activity across different pH values, temperatures, and salt concentrations.

Control experiments should include heat-inactivated enzyme and known inhibitors of fumarate reductase. Additionally, researchers should compare the recombinant protein's activity to that of the native enzyme complex when possible, accounting for potential differences introduced by purification tags or expression systems.

What methodological approaches can be used to study the membrane integration of frdC?

Investigating the membrane integration of frdC requires specialized techniques that address its hydrophobic nature and transmembrane orientation. Researchers can employ multiple complementary methods to characterize how this protein anchors within bacterial membranes:

When implementing these methods, researchers should consider the highly hydrophobic nature of frdC and optimize protocols accordingly. For instance, when using detergent solubilization for biochemical studies, the choice of detergent is critical—mild non-ionic detergents like n-dodecyl-β-D-maltoside often preserve functional integrity better than harsh ionic detergents. Additionally, reconstitution into liposomes or nanodiscs can provide a more native-like environment for functional studies of membrane-integrated frdC.

How can recombinant frdC be utilized in structural biology studies?

Recombinant Serratia proteamaculans frdC provides valuable opportunities for structural biology investigations, particularly when studying membrane protein complexes involved in anaerobic respiration. To effectively utilize this protein in structural studies, researchers should employ a strategic approach that accounts for its hydrophobic nature and membrane integration properties.

For X-ray crystallography, successful crystallization often requires detergent screening to identify conditions that maintain protein stability while promoting crystal formation. The His-tagged versions of frdC offer advantages for purification through immobilized metal affinity chromatography (IMAC), which can be followed by size exclusion chromatography to ensure homogeneity. For cryo-electron microscopy (cryo-EM), the entire fumarate reductase complex including frdC can be reconstituted into nanodiscs or studied in detergent micelles to preserve native-like environments.

NMR spectroscopy presents another viable approach, particularly for studying dynamics and ligand interactions. For this method, isotope labeling of recombinant frdC (typically with 15N, 13C, and sometimes 2H) requires optimization of expression conditions in minimal media. The 130 amino acid length of the protein makes it amenable to solution NMR studies when properly solubilized.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable insights into the solvent accessibility and conformational dynamics of different regions of frdC, complementing static structural data from crystallography or cryo-EM. This information is particularly relevant for understanding how frdC anchors the fumarate reductase complex in the membrane.

What role does frdC play in bacterial adaptation to anaerobic environments?

Fumarate reductase subunit C plays a crucial role in bacterial adaptation to oxygen-limited or anaerobic environments through its function in alternative respiratory pathways. As the membrane anchor component of the fumarate reductase complex, frdC enables the coupling of electron transport to fumarate reduction, allowing bacteria to use fumarate as a terminal electron acceptor in the absence of oxygen .

This metabolic versatility provides significant ecological advantages. In environments where oxygen is scarce, such as soil sediments, intestinal tracts, or biofilms, bacteria expressing functional fumarate reductase complexes can continue to generate energy through anaerobic respiration rather than shifting to less efficient fermentative metabolism. The ability to use fumarate as an electron acceptor contributes to the colonization of anaerobic niches and persistence during environmental oxygen fluctuations.

Research has demonstrated that fumarate reductase expression is typically regulated by oxygen availability, with increased expression under anaerobic conditions. The membrane anchor function of frdC is essential for proper localization of the enzyme complex within the bacterial membrane, facilitating efficient electron transfer from quinol electron carriers to the catalytic subunits of the complex. Thus, the structural integrity and correct membrane integration of frdC directly impact the efficiency of anaerobic respiration.

From an evolutionary perspective, the presence and conservation of frdC across diverse bacterial species, including Serratia proteamaculans and Yersinia pestis , highlights its fundamental importance in microbial adaptation strategies. Comparative studies of frdC between bacterial species that occupy different ecological niches could provide insights into how this protein has evolved to support survival in specific anaerobic environments.

How can researchers effectively compare frdC function across different bacterial species?

Conducting meaningful cross-species comparisons of frdC function requires a systematic approach that accounts for evolutionary, structural, and physiological differences between bacterial species. Researchers should implement a multidimensional comparative framework that integrates sequence analysis, structural biology, and functional biochemistry.

Sequence alignment tools should be used to compare frdC proteins from different species, such as those from Serratia proteamaculans (UniProt: A8G8T5) and Yersinia pestis (UniProt: Q8ZIX7) , identifying conserved domains and species-specific variations. These alignments can inform hypotheses about structure-function relationships and guide the design of chimeric proteins to test the functional significance of specific regions.

Experimental approaches should include:

• Heterologous expression studies: Express frdC from different species in a common host organism and assess membrane integration efficiency and complex formation.

• Complementation assays: Test whether frdC from one species can functionally replace the native protein in another species, particularly in frdC knockout strains.

• Kinetic measurements: Compare fumarate reductase activity parameters (Km, Vmax, catalytic efficiency) when assembled with frdC from different species under identical experimental conditions.

• Environmental response profiling: Assess how frdC from different species responds to variations in pH, temperature, salt concentration, and redox conditions.

• Structural comparisons: Use techniques like circular dichroism spectroscopy to compare secondary structure content and thermal stability across species variants.

When publishing comparative studies, researchers should clearly document experimental conditions to facilitate reproducibility and accurately report both similarities and differences observed between species. These comparisons can provide valuable insights into the evolution of anaerobic respiration and species-specific adaptations to particular ecological niches.

How do post-translational modifications affect frdC function and membrane integration?

Post-translational modifications (PTMs) of frdC can significantly influence its membrane integration, stability, protein-protein interactions, and ultimately, the function of the entire fumarate reductase complex. Although not extensively characterized for Serratia proteamaculans frdC specifically, research on related membrane proteins suggests several potential modification types that could affect functionality.

Phosphorylation of serine, threonine, or tyrosine residues within frdC could alter the protein's conformation or electrostatic properties, potentially affecting interactions with other subunits of the fumarate reductase complex. Particularly, phosphorylation sites near the membrane-cytoplasm interface might regulate complex assembly or stability. Researchers investigating this aspect should employ phosphoproteomic approaches using mass spectrometry to identify potential phosphorylation sites under different growth conditions.

Lipid modifications, such as palmitoylation, could enhance membrane association and alter the orientation of frdC within the lipid bilayer. Such modifications might be particularly relevant for optimizing the positioning of the entire enzyme complex relative to quinol electron donors in the membrane. Techniques like click chemistry with alkyne-tagged palmitic acid analogs can help identify potential lipidation sites.

Oxidative modifications represent another important consideration, particularly in bacteria transitioning between aerobic and anaerobic environments. Cysteine residues within frdC might undergo reversible oxidation, potentially serving as redox sensors that modulate activity based on environmental conditions. Differential alkylation approaches coupled with mass spectrometry can reveal such oxidative modifications.

To comprehensively investigate the impact of PTMs on frdC function, researchers should develop an integrated workflow combining site-directed mutagenesis of potential modification sites, in vitro modification systems, and functional assays measuring both membrane integration efficiency and fumarate reductase activity. Advanced structural techniques like hydrogen-deuterium exchange mass spectrometry can further reveal how specific modifications alter protein dynamics and accessibility.

What are the experimental challenges in determining the interaction between frdC and other fumarate reductase subunits?

Investigating the molecular interactions between frdC and other fumarate reductase subunits presents several significant experimental challenges that researchers must address through specialized methodologies. The membrane-embedded nature of frdC creates fundamental difficulties in maintaining protein stability and native conformation during purification and analysis procedures.

One primary challenge involves the solubilization of the intact complex without disrupting the native interactions. Conventional detergent-based extraction methods may destabilize the complex or alter the conformation of frdC. Researchers should systematically screen multiple detergents, ranging from harsh (SDS) to mild (digitonin, DDM), or consider newer approaches like styrene-maleic acid lipid particles (SMALPs) that extract membrane proteins with their surrounding lipid environment intact.

Cross-linking mass spectrometry (XL-MS) offers a powerful approach for mapping interaction interfaces but requires careful optimization when applied to membrane protein complexes. Various cross-linking reagents with different spacer arm lengths and chemical specificities should be evaluated to identify those that can effectively capture interactions involving the hydrophobic regions of frdC. The subsequent mass spectrometry analysis presents computational challenges in identifying cross-linked peptides from membrane proteins.

Co-immunoprecipitation approaches are further complicated by the need for antibodies that recognize epitopes accessible in the membrane-embedded complex. For co-expression studies, researchers must ensure proper folding and membrane integration of all subunits, which may require specialized expression systems with appropriate chaperones and membrane insertion machinery.

How can researchers develop inhibitors targeting frdC for potential antimicrobial applications?

Developing inhibitors that specifically target frdC represents a sophisticated approach to antimicrobial drug discovery, leveraging the absence of fumarate reductase in mammalian cells to achieve selective toxicity against bacterial pathogens. A methodical research pipeline for this objective should integrate computational, biochemical, and microbiological approaches.

The initial phase should focus on identifying druggable sites through computational analysis of frdC structure, particularly at interfaces with other subunits or regions involved in electron transfer. Molecular dynamics simulations can reveal transient pockets not obvious in static structures. Virtual screening of compound libraries against these sites can generate preliminary hit compounds, which should be filtered for drug-like properties and synthetic accessibility.

Biochemical validation requires establishing robust assays to evaluate binding and inhibition:

• Direct binding assays: Techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) using purified recombinant frdC can confirm physical interaction with candidate inhibitors.

• Functional inhibition assays: Measuring fumarate reductase activity in membrane preparations or reconstituted systems in the presence of inhibitors can demonstrate functional consequences of binding.

• Membrane permeability assays: Since inhibitors must traverse the bacterial outer membrane (in Gram-negative bacteria), techniques like PAMPA (Parallel Artificial Membrane Permeability Assay) should be employed early in development.

For promising candidates, structure-activity relationship (SAR) studies should guide medicinal chemistry optimization of potency, selectivity, and pharmacokinetic properties. The optimized compounds should then be evaluated in whole-cell assays under anaerobic conditions, where bacteria rely more heavily on fumarate reductase activity. Importantly, researchers should assess activity against both planktonic bacteria and biofilms, where anaerobic microenvironments often develop.

Resistance potential should be evaluated through serial passage experiments, and mechanism of action should be confirmed through techniques like selection and sequencing of resistant mutants, or metabolomic profiling to demonstrate downstream metabolic effects consistent with fumarate reductase inhibition.

What methodological approaches can resolve contradictory data regarding frdC membrane topology?

Resolving contradictory data about frdC membrane topology requires a comprehensive, multi-technique approach that addresses the limitations of individual methods. Membrane protein topology determination is inherently challenging due to the dynamic nature of membrane interfaces and technical difficulties in studying hydrophobic proteins. When faced with conflicting topology models for Serratia proteamaculans frdC, researchers should implement a systematic resolution strategy.

First, researchers should critically evaluate existing contradictory data by examining the methodologies used, considering their known limitations. For example, computational prediction algorithms may disagree due to different underlying assumptions, while experimental approaches like protease accessibility might be affected by local structural features that protect theoretically exposed sites.

A hierarchical experimental approach incorporating complementary techniques should be implemented:

• Site-directed cysteine scanning combined with sulfhydryl labeling: By introducing single cysteine residues throughout the protein sequence and assessing their accessibility to membrane-impermeable sulfhydryl reagents, researchers can map which regions face the cytoplasm versus periplasm or extracellular space.

• Reporter fusion analysis: Creating systematic fusions of segments of frdC with reporter proteins like alkaline phosphatase (active in periplasm) and β-galactosidase (active in cytoplasm) can provide topology information based on reporter activity.

• Glycosylation mapping: For expression systems supporting glycosylation, engineered glycosylation sites can indicate lumenal/extracellular exposure.

• Cross-linking mass spectrometry with enrichment: Using membrane-impermeable and membrane-permeable cross-linkers with differential isotope labeling can distinguish spatial relationships.

• Hydrogen-deuterium exchange mass spectrometry: Examining differential exchange rates across the protein can indicate solvent-exposed versus membrane-embedded regions.

To address potential artifacts, researchers should validate findings across different membrane environments (detergents, nanodiscs, liposomes) and expression systems. When possible, cryo-electron microscopy of the intact fumarate reductase complex can provide direct structural evidence of frdC topology.

Importantly, researchers should consider that apparent contradictions might reflect genuine biological flexibility—frdC topology might change during complex assembly or under different physiological conditions. Time-resolved experiments examining topology during expression and membrane insertion could reveal dynamic aspects overlooked in static analyses.

What are the future research directions for understanding frdC structure-function relationships?

The future of frdC research presents exciting opportunities to deepen our understanding of membrane protein biology and bacterial energy metabolism. Several promising research directions emerge from current knowledge gaps and technological advances in the field. Integrating structural biology with functional analyses will remain central to advancing our understanding of how frdC contributes to fumarate reductase complex activity and bacterial adaptation.

Single-particle cryo-electron microscopy offers unprecedented potential to resolve the complete structure of the fumarate reductase complex containing frdC at near-atomic resolution, particularly when combined with advanced specimen preparation techniques like graphene support films to improve particle orientation distribution. This structural information could reveal critical interaction interfaces and conformational states previously inaccessible to traditional crystallographic approaches.

The development of genetic code expansion systems to incorporate unnatural amino acids at specific positions within frdC could enable precise probing of structure-function relationships through techniques like site-specific photocrosslinking, fluorescent labeling, or introduction of biophysical probes. Such approaches could illuminate dynamic aspects of frdC function within the membrane environment.

Systems biology approaches integrating transcriptomics, proteomics, and metabolomics could reveal how frdC expression and modification patterns change across diverse growth conditions, particularly during transitions between aerobic and anaerobic states. This could identify novel regulatory mechanisms controlling fumarate reductase complex assembly and activity.

The application of advanced computational approaches like molecular dynamics simulations with enhanced sampling techniques could model how frdC interacts with membrane lipids and other fumarate reductase subunits. Machine learning approaches might predict functional impacts of sequence variations observed across bacterial species, generating testable hypotheses about evolutionary adaptations.

As new antimicrobial development strategies emerge, structure-based drug design targeting frdC or its interactions with other subunits could yield novel compounds selective for bacterial pathogens, addressing the growing challenge of antimicrobial resistance through exploitation of this bacteria-specific metabolic pathway.

How might technological advances in membrane protein research impact our understanding of frdC?

Emerging technologies in membrane protein research promise to revolutionize our understanding of frdC structure, dynamics, and function in the coming years. These methodological advances will likely overcome current limitations and provide unprecedented insights into this critical component of bacterial anaerobic respiration.

Advanced cryo-electron microscopy (cryo-EM) techniques, particularly those employing direct electron detectors with improved quantum efficiency and energy filters, now enable visualization of membrane protein complexes at resolutions approaching 2Å. Applied to the fumarate reductase complex containing frdC, these approaches could reveal atomic-level details of subunit interfaces and conformational changes associated with electron transfer. Time-resolved cryo-EM, though still developing, holds promise for capturing dynamic states of the complex during catalysis.

Native mass spectrometry adapted for membrane proteins can now maintain intact membrane protein complexes in the gas phase, allowing determination of subunit stoichiometry, binding partners, and even lipid interactions. This could clarify how frdC associates with specific lipids that might influence fumarate reductase activity or membrane localization. Ion mobility mass spectrometry further enables analysis of conformational states that might not be captured by crystallography or cryo-EM.

In situ structural biology approaches, such as cryo-electron tomography with subtomogram averaging, offer the revolutionary potential to study frdC in its native membrane environment without extraction or purification. This could reveal native arrangements, clustering behaviors, or interactions with other membrane components that are lost during traditional purification procedures.

Single-molecule techniques including high-speed atomic force microscopy (HS-AFM) can now visualize membrane proteins at work with nanometer resolution and sub-second temporal resolution. Applied to reconstituted systems containing frdC, these approaches could reveal dynamic aspects of complex assembly and conformational changes during electron transfer events.

Microfluidic platforms for rapid membrane protein reconstitution and functional screening could accelerate structure-function studies by enabling high-throughput analysis of frdC variants. Combined with automated data collection and analysis pipelines leveraging artificial intelligence, these systems could systematically map the functional consequences of mutations throughout the frdC sequence.