Recombinant Serratia proteamaculans Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
frdD; Spro_0416; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
frdD
Target Protein Sequence
MINQAPKRSDEPVFWGLFGAGGMWGAIIAPAIVLLVGILLPLGLFPGDALGYDRILAFCQ SLIGRLFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLAAILSVVTVIGVVTL
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized in anaerobic growth, while succinate dehydrogenase functions in aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of fumarate reductase in Serratia proteamaculans?

S. proteamaculans contains the frdABCD operon encoding the four subunits of fumarate reductase. The genome sequence of S. proteamaculans strain 568 contains this operon with frdD specifically labeled as locus Spro_0416. The complete genome consists of a 5,324,944 bp circular chromosome and a 129,797 bp circular plasmid, with the frd operon located on the main chromosome . Fumarate reductase genes are typically co-expressed with other genes involved in anaerobic respiration, as RNA-seq data has shown substantial regulation of formate fermentation-related genes including the frdABCD cluster .

How does FrdD function within the fumarate reductase complex?

FrdD serves as one of two hydrophobic membrane anchor subunits (along with FrdC) of the fumarate reductase complex. Research on homologous systems in E. coli demonstrates that both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues . When separated from the other subunits, the complex cannot properly assemble into a functional unit. The FrdD protein works cooperatively with FrdC to anchor the catalytic subunits (FrdA and FrdB) to the cytoplasmic membrane, facilitating electron transfer from quinol to fumarate during anaerobic respiration .

What are the optimal conditions for heterologous expression of S. proteamaculans FrdD?

Based on published methodologies, S. proteamaculans FrdD is optimally expressed in E. coli expression systems using vectors containing N-terminal His-tags for purification purposes. Expression should be conducted at lower temperatures (16-22°C) after IPTG induction to minimize inclusion body formation of this hydrophobic membrane protein. The optimal protocol includes:

  • Transformation into E. coli BL21(DE3) or similar expression strains

  • Growth in LB media supplemented with appropriate antibiotics to OD600 of 0.6-0.8

  • Induction with 0.1-0.5 mM IPTG

  • Post-induction expression at 18°C for 16-20 hours

  • Cell harvest by centrifugation at 5,000 × g for 20 minutes

For membrane proteins like FrdD, adding 1% glucose to the pre-induction media helps reduce leaky expression. Optimization of expression conditions may be necessary depending on the specific research goals and construct design .

What methods are most effective for purification of recombinant S. proteamaculans FrdD?

Purification of FrdD requires specialized approaches due to its hydrophobic nature. The most effective protocol combines:

  • Cell lysis in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 1% detergent (typically n-dodecyl-β-D-maltoside or Triton X-100)

  • Sonication or high-pressure homogenization for efficient membrane disruption

  • Centrifugation at 20,000 × g to remove cell debris

  • Membrane fraction solubilization with 1-2% detergent for 1-2 hours at 4°C

  • Affinity chromatography using Ni-NTA resin

  • Washing with buffer containing 20-40 mM imidazole

  • Elution with buffer containing 250-300 mM imidazole

  • Size-exclusion chromatography for further purification

Maintaining 0.05-0.1% detergent throughout purification is critical to prevent protein aggregation. The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

How can researchers overcome the challenges of expressing the complete functional fumarate reductase complex?

Expression of the complete functional fumarate reductase complex presents significant challenges due to the requirement for all four subunits to assemble correctly. Research on E. coli has shown that:

  • All four fumarate reductase subunits must be co-expressed for restoration of function

  • The separation of genes coding for FrdC and FrdD affects the complex's ability to assemble properly

  • The FrdA and FrdB dimer forms the catalytic core but requires both FrdC and FrdD for membrane association and quinone interaction

To achieve functional expression:

  • Use a polycistronic expression system containing all four genes (frdABCD) in their natural order

  • Maintain the appropriate spacing between genes to ensure proper translation

  • Consider using native promoter elements to maintain natural expression ratios

  • Express in an E. coli strain lacking endogenous fumarate reductase (such as a ΔfrdABCD strain) to avoid contamination with host proteins

  • Validate function through complementation assays measuring anaerobic growth on glycerol and fumarate

Research indicates that expression of FrdD separately from the other components typically does not yield functional complexes .

How can researchers assess the functionality of recombinant S. proteamaculans FrdD in vitro?

Assessment of FrdD functionality requires evaluation within the context of the complete fumarate reductase complex. Key methodological approaches include:

Analytical MethodProcedureExpected Results
Benzyl viologen oxidase assayMeasure the rate of benzyl viologen oxidation coupled to fumarate reductionActive FrdAB dimer shows activity; complete complex shows higher activity
Quinone reductase assayMonitor the oxidation of reduced quinone analogues (menaquinol) coupled to fumarate reductionRequires all four subunits for activity
Membrane association assayFractionate membranes and assess protein distribution via Western blottingFrdD and FrdC required for membrane localization
Anaerobic growth complementationExpress in ΔfrdABCD E. coli and assess growth on glycerol/fumarate mediumFull complex restores growth under anaerobic conditions
Native gel electrophoresisAnalyze complex formation under non-denaturing conditionsIntact complex should migrate as a single band

These assays should be performed with appropriate controls, including known functional fumarate reductase complexes from E. coli as positive controls .

What analytical techniques can be used to study the structure-function relationship of S. proteamaculans FrdD?

Several sophisticated analytical techniques can reveal structure-function relationships in FrdD:

How does the function of FrdD in S. proteamaculans relate to the organism's ecological adaptations?

S. proteamaculans can thrive in diverse environments including plant rhizosphere, insect gut microbiomes, and decomposing organic matter. The fumarate reductase complex, including FrdD, plays a crucial role in these adaptations by:

  • Enabling anaerobic respiration: S. proteamaculans isolated from decomposing wood and soil environments frequently encounters oxygen-limited conditions where fumarate respiration provides a metabolic advantage .

  • Supporting plant growth promotion: As a plant growth-promoting bacterium, S. proteamaculans must adapt to the low-oxygen rhizosphere environment. RNA-seq data shows substantial regulation of fumarate reductase genes during plant-associated growth .

  • Contributing to insect gut colonization: S. proteamaculans is frequently isolated from insect gut microbiota, including spiders and bark beetles, where oxygen is limited and alternative electron acceptors like fumarate are important .

  • Participating in antagonistic activity: The organism shows remarkable antagonistic traits against plant pathogens, and its metabolic versatility, including anaerobic respiration capabilities, may contribute to its competitive advantage in these environments .

What is the potential biotechnological significance of recombinant S. proteamaculans FrdD?

Recombinant S. proteamaculans FrdD has several potential biotechnological applications:

  • Biocatalysis and bioremediation:

    • The complete fumarate reductase complex can catalyze the reduction of fumarate to succinate, which is useful for green chemistry applications

    • Potential use in bioremediation of environments contaminated with oxidized organic compounds

  • Bioelectrochemical systems:

    • Integration into microbial fuel cells for electricity generation

    • Development of bioelectrochemical sensors for anaerobic conditions

  • Agricultural applications:

    • Engineering plant-associated bacteria with enhanced anaerobic capabilities for improved plant growth promotion

    • Development of biocontrol agents with improved rhizosphere competence

  • Biomimetic nanocatalysts:

    • Design of biomimetic nanocatalysts based on the structure and function of the fumarate reductase complex

    • Creation of artificial electron transport chains for industrial catalysis

  • Structural research platform:

    • Use as a model system for studying membrane protein complexes

    • Research platform for developing improved membrane protein expression and purification methods

Each application requires careful optimization of expression systems, protein engineering for stability, and integration with other biological or synthetic components .

How might the study of S. proteamaculans FrdD contribute to understanding bacterial adaptation to different environmental niches?

Studying S. proteamaculans FrdD can provide insights into bacterial adaptation mechanisms:

  • Oxygen gradient adaptation:

    • FrdD as part of the fumarate reductase complex is crucial for adaptation to oxygen-limited environments

    • Comparative analysis of FrdD sequences from strains isolated from different oxygen environments can reveal adaptive mutations

  • Host-microbe interactions:

    • S. proteamaculans colonizes diverse hosts including plants and insects

    • Analysis of FrdD expression during host colonization can reveal its role in adaptation to host-associated environments

  • Biofilm formation and persistence:

    • Anaerobic respiration is often critical for bacterial survival in biofilms

    • Investigation of FrdD's role in biofilm persistence and antibiotic tolerance

  • Horizontal gene transfer and evolution:

    • Comparative genomic analysis of the frd operon across Serratia species can reveal patterns of horizontal gene transfer

    • Identification of selection pressures acting on FrdD in different environments

  • Metabolic versatility:

    • Understanding how fumarate respiration integrates with other metabolic pathways

    • Elucidating the regulatory networks controlling respiratory flexibility

This research contributes to fundamental understanding of bacterial adaptation strategies and may inform approaches to manipulate bacterial communities in various ecosystems .

What strategies can researchers employ when expression of S. proteamaculans FrdD results in protein aggregation?

Protein aggregation is a common challenge when expressing hydrophobic membrane proteins like FrdD. Recommended troubleshooting strategies include:

  • Optimization of expression conditions:

    • Reduce induction temperature to 16°C

    • Decrease IPTG concentration to 0.1 mM

    • Shorten induction time to 4-6 hours

    • Try auto-induction media for gradual protein expression

  • Fusion tags and solubility enhancers:

    • Use solubility-enhancing fusion partners (MBP, SUMO, or Trx)

    • Add 5-10% glycerol to expression media

    • Include mild detergents (0.1% Triton X-100) in lysis buffer

  • Codon optimization and expression hosts:

    • Optimize codons for expression host

    • Test specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Consider cell-free expression systems

  • Co-expression strategies:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Co-express with other fumarate reductase subunits

    • Include rare tRNA-expressing plasmids

  • Alternative solubilization methods:

    • Screen different detergents (DDM, LDAO, CHAPS)

    • Try detergent mixtures

    • Explore amphipols or nanodiscs for stabilization

For extremely difficult cases, consider direct membrane isolation followed by in situ functional studies rather than attempting complete purification of the individual subunit .

How can researchers distinguish between specific and non-specific activities when characterizing recombinant S. proteamaculans FrdD?

Distinguishing specific from non-specific activities requires rigorous experimental controls:

Control TypeImplementationPurpose
Negative controlsExpress and purify an unrelated membrane proteinEstablish baseline for non-specific effects
Mutation controlsCreate catalytically inactive mutantsConfirm activity is due to the specific protein
Inhibitor studiesTest specific inhibitors of fumarate reductaseVerify that activity responds to known inhibitors
Complex reconstitutionCompare isolated FrdD vs. reconstituted complexDemonstrate functional assembly
Substrate specificityTest activity with related and unrelated substratesConfirm expected substrate preferences
Competition assaysPerform activity assays with competitive inhibitorsValidate binding site specificity
Functional complementationExpress in ΔfrdD strainsConfirm in vivo functionality

Additionally, researchers should use multiple independent methods to assess protein activity and employ statistical analysis to determine significance of observed differences between experimental and control samples .

What are the critical considerations when designing site-directed mutagenesis experiments for S. proteamaculans FrdD?

When designing site-directed mutagenesis experiments for FrdD, researchers should consider:

  • Selection of target residues:

    • Focus on conserved amino acids identified through multiple sequence alignments

    • Target residues at predicted subunit interfaces

    • Examine residues in transmembrane regions

    • Consider residues near predicted quinone binding sites

  • Mutation design principles:

    • Start with conservative substitutions that maintain similar physiochemical properties

    • Progress to more disruptive mutations to test functional hypotheses

    • Consider alanine-scanning mutagenesis for systematic analysis

    • Create double or triple mutants to test functional redundancy

  • Experimental validation approaches:

    • Verify proper protein expression and membrane localization

    • Assess impact on complex assembly using co-immunoprecipitation

    • Measure enzymatic activity of the fumarate reductase complex

    • Evaluate membrane integration using protease protection assays

  • Structure-function correlation:

    • Use homology models based on related proteins with known structures

    • Map mutations onto predicted structural models

    • Correlate functional effects with structural context

  • Controls and reproducibility:

    • Include wild-type constructs processed in parallel

    • Create both loss-of-function and gain-of-function predictions

    • Verify mutations by sequencing before and after expression

This systematic approach enables detailed mapping of structure-function relationships in the FrdD protein and its interactions within the fumarate reductase complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.