Recombinant Serratia proteamaculans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

Mechanosensitive channels (MS channels) are integral membrane proteins that respond to mechanical stimuli such as membrane stretch, pressure, or force, by opening or closing a channel pore, allowing ions and other small molecules to flow across the cell membrane . These channels are found in all living organisms, from bacteria to mammals, and play important roles in a variety of physiological processes, including osmoregulation, touch sensation, hearing, and blood pressure regulation .

The Large-conductance Mechanosensitive Channel (MscL) is one of the best-studied MS channels. MscL is a relatively simple protein, consisting of only about 150 amino acids, and it forms a homopentameric channel complex in the membrane . The structure of MscL has been solved by X-ray crystallography and cryo-electron microscopy, providing detailed insights into its architecture and gating mechanism .

Serratia proteamaculans is a Gram-negative bacterium known for its ability to produce various extracellular enzymes and its potential in biotechnological applications . The MscL from Serratia proteamaculans, when produced using recombinant DNA technology, is termed Recombinant Serratia proteamaculans Large-conductance Mechanosensitive Channel (MscL) . This recombinant protein is utilized in various research applications, including drug delivery andLive cell permeabilization .

Structure and Function of MscL

MscL forms a homopentamer, with each subunit containing two transmembrane segments (TM1 and TM2) . The pore of the channel is primarily lined by TM1, which contains a cluster of hydrophobic amino acids that constrict the pore . The diameter of the open MscL pore is greater than 25 Å, allowing the passage of large organic ions and small proteins .

MscL functions as a pressure valve in bacteria . It opens in response to increased membrane tension, which can occur due to osmotic shock or other environmental stresses . The opening of the channel allows ions and water to flow out of the cell, relieving the pressure and preventing cell lysis .

Recombinant Production and Applications

Recombinant MscL can be produced in various expression systems, including E. coli and mammalian cells . The recombinant protein retains its mechanosensitive properties and can be used for various applications, including:

  • Drug Delivery: MscL can be used to deliver drugs and other therapeutic molecules into cells . By controlling the opening and closing of the channel, researchers can precisely control the delivery of these molecules.

  • Live Cell Permeabilization: MscL can be used to permeabilize cells, allowing the entry of molecules that are normally impermeable to the cell membrane . This can be useful for studying cellular processes or for delivering therapeutic molecules.

  • Nanotechnology: MscL can be used as a building block for nanoscale devices . Its ability to open and close in response to mechanical stimuli can be used to create sensors and actuators.

MscL in Serratia Species

Serratia proteamaculans is known for producing various enzymes and exhibiting antagonistic traits against plant pathogens . The MscL in Serratia contributes to the bacterium's survival under stress conditions. Serratia marcescens, another species in the Serratia genus, utilizes a secreted metalloprotease called serralysin to suppress host cellular immunity by degrading adhesion molecules .

Research Findings

Research AreaFindings
Protein ProfileProteomic analysis of Serratia marcescens identified 15,009 unique peptides mapping to 2,541 unique protein groups, corresponding to approximately 54% of the predicted protein-coding genes .
Laccase ActivitySerratia proteamaculans AORB19 exhibits laccase activity, confirmed by the formation of reddish-brown and green-colored zones on guaiacol and ABTS agar plates, respectively .
Chitin Binding ProteinsSerratia proteamaculans 568 possesses three family 33 chitin-binding proteins (CBPs), with Sp CBP21 and Sp CBP50 showing binding preference to β-chitin and synergizing with chitinases in chitin degradation .
Immune SuppressionSerralysin metalloprotease secreted by Serratia marcescens suppresses cellular immunity by degrading adhesion molecules . Incubation of silkworm hemocytes or murine macrophages with serralysin resulted in degradation of the cellular immune factor BmSPH-1 or calreticulin, respectively .
Molecular DeliveryMscL can be functionally expressed in mammalian cells to afford rapid controlled uptake of membrane-impermeable molecules . Charge-induced activation of MscL G26C is a useful method to deliver ∼700 Da molecules into mammalian cells . The upper size limit for molecules that can diffuse through MscL under the conditions tested was ≤ 10,000 Da .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Spro_4515; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
mscL
Target Protein Sequence
MSMMKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSFVADIIMPPLGLLIGGVDFKQFHLV LREAQGAVPAVVMNYGSFIQTIFDFVIVAFAIFLAIKLMNKVRRKQEEAPAAPPAPTAEE KLLTEIRDLLSQQQQPKL
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Serratia proteamaculans and why is it relevant for mscL research?

Serratia proteamaculans is a gram-negative, non-pigmented γ-proteobacterium that is widely distributed in nature. It is frequently isolated from diverse environments including the gut microbiota of insects such as spiders and bark beetles . S. proteamaculans has gained scientific interest due to its remarkable ability to produce various biodegradative enzymes and its antagonistic traits against plant pathogens .

What is the structure and function of bacterial mscL channels?

The large-conductance mechanosensitive channel (mscL) is a membrane protein that plays a crucial role in bacterial osmoregulation by responding to membrane tension. Structurally, mscL consists of several key components:

  • Transmembrane domains that form the channel pore

  • An amphipathic N-terminal helix that serves as a crucial structural element

  • A C-terminal domain involved in channel assembly and regulation

The mscL channel functions as a biological emergency release valve that gates in response to membrane tension. This tension is transmitted directly to the channel from the lipid bilayer, resulting in a conformational change that opens the channel . This mechanism allows bacteria to rapidly release cytoplasmic contents and prevent cell lysis during sudden osmotic downshock .

Research has demonstrated that the amphipathic N-terminal helix of mscL plays a dual role: stabilizing the closed state of the channel and coupling the channel to the membrane . This structural feature may represent a common principle in the gating cycle of mechanosensitive ion channels, enabling the coupling of channel conformation to membrane dynamics .

What expression systems are optimal for recombinant S. proteamaculans mscL production?

When selecting an expression system for recombinant S. proteamaculans mscL, researchers should consider several factors:

  • Host compatibility: E. coli remains the most widely used expression host for bacterial membrane proteins due to its well-characterized genetics and rapid growth. For S. proteamaculans proteins specifically, E. coli is particularly suitable due to the phylogenetic relationship between the organisms.

  • Expression vectors: Vectors with tunable promoters (like pET or pBAD series) allow controlled expression, which is crucial for membrane proteins that can be toxic when overexpressed.

  • Fusion tags strategy: N-terminal or C-terminal tags can assist in purification and detection. For mscL channels, C-terminal tags are generally preferred as the N-terminus plays a critical role in channel function as demonstrated in MscL studies, where the amphipathic N-terminal helix acts as a crucial structural element during tension-induced gating .

  • Codon optimization: Though S. proteamaculans and E. coli have similar codon usage, optimization might improve expression yields.

  • Membrane incorporation: Specialized E. coli strains like C41(DE3) or C43(DE3) are designed for toxic membrane protein expression and may improve yields.

Based on successful approaches with other bacterial mechanosensitive channels, a recommended expression strategy would utilize the pET system in C41(DE3) E. coli cells with induction at lower temperatures (18-25°C) to promote proper folding.

What purification challenges are specific to recombinant mscL channels?

Purifying recombinant mscL channels presents several challenges that require specific methodological approaches:

  • Detergent selection: The choice of detergent is critical for maintaining mscL structure and function. A systematic approach testing multiple detergents (DDM, LDAO, OG) is recommended, as different mscL homologs may exhibit varying stability in different detergents.

  • Solubilization efficiency: Membrane extraction conditions must be optimized to efficiently solubilize mscL without denaturation. Typically, a two-step process involving membrane isolation followed by solubilization yields better results than direct solubilization from whole cells.

  • Protein aggregation: MscL tends to form aggregates during purification. Including glycerol (10-15%) in buffers and maintaining samples at 4°C can minimize aggregation.

  • Maintaining native conformation: The functional state of mscL is highly dependent on lipid interactions. Incorporating lipids (such as E. coli total lipid extract) during purification can help maintain native-like properties.

  • Functional verification: Unlike enzymatic proteins, verification of mscL functionality requires specialized electrophysiological techniques, as demonstrated in studies with other MscL channels where patch-clamp electrophysiology was used to assess channel function .

A recommended purification workflow would involve membrane fraction isolation, solubilization with a mild detergent like DDM, affinity chromatography using a C-terminal His-tag, and size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

How can researchers verify the proper folding and functionality of purified recombinant mscL?

Verifying the proper folding and functionality of purified recombinant mscL involves multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify oligomeric state

    • Limited proteolysis to assess the compactness of the folded structure

  • Functional assays:

    • Liposome reconstitution followed by patch-clamp electrophysiology is the gold standard for functional verification

    • Downshock assays in E. coli lacking endogenous mscL to assess complementation, similar to approaches used in other MscL studies that demonstrated protection from hypo-osmotic downshock

    • Fluorescence-based assays using calcein-loaded liposomes to measure channel activity

  • Binding studies:

    • Lipid binding assays to confirm interaction with membrane components

    • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy to assess mobility parameters of specific residues, particularly in the N-terminal region which has been shown to be critical for MscL function

A comprehensive verification approach would include both structural and functional assessments, with particular attention to the N-terminal region that has been demonstrated to be crucial for tension-induced gating in MscL channels .

What experimental designs are most appropriate for studying S. proteamaculans mscL function?

When designing experiments to study S. proteamaculans mscL function, researchers should consider systematic approaches that control for variables affecting channel behavior:

  • Latin Square Design (LSD): This experimental design is particularly valuable when multiple factors need to be controlled simultaneously . For mscL studies, this could include:

    • Testing different lipid compositions

    • Varying membrane tension parameters

    • Comparing different mutations or constructs

    In an LSD, experimental treatments are arranged such that each treatment occurs exactly once in each row and exactly once in each column . This removes two sources of variability from the experimental error, making it more efficient than completely randomized designs or randomized block designs .

  • Factorial designs: When investigating how multiple factors interact to affect mscL function (e.g., lipid composition, pH, and ionic strength), factorial designs allow for efficient testing of main effects and interactions.

  • Mutation series designs: Systematic mutation of key residues, particularly in the N-terminal region known to be critical for MscL function , should follow a logical progression:

    • Alanine scanning of the entire N-terminal region

    • Charge substitutions at key positions

    • Conservative vs. non-conservative substitutions

    • Deletion series (such as Δ2–7 constructs used in other MscL studies)

  • Controls: Critical controls should include:

    • Comparison with well-characterized mscL channels (e.g., E. coli MscL)

    • Expression level normalization across constructs

    • Membrane composition consistency or systematic variation

For electrophysiological studies, patch-clamp experiments should be designed to enable calculation of the force required for channel gating under different conditions, similar to protocols used in other MscL studies .

How can patch-clamp electrophysiology be optimized for S. proteamaculans mscL functional analysis?

Patch-clamp electrophysiology represents the gold standard for functional characterization of mechanosensitive channels. For optimal results with S. proteamaculans mscL, several methodological considerations should be addressed:

  • Membrane preparation:

    • Giant spheroplasts from bacterial cells or

    • Reconstitution into giant unilamellar vesicles (GUVs) or

    • Planar lipid bilayers

  • Patch configuration optimization:

    • Inside-out patches are preferred for mechanosensitive channel studies

    • Pipette size and geometry significantly affect seal quality and stability

    • Glass treatment with Sigmacote or similar agents improves seal formation

  • Pressure application protocols:

    • Stepped pressure increases provide detailed activation profiles

    • Pressure ramps allow determination of activation thresholds

    • Sustained pressure applications test channel adaptation

  • Data acquisition parameters:

    • Sampling rates of ≥10 kHz are recommended

    • Filtering at 2-5 kHz provides optimal signal-to-noise ratio

    • Capacitance compensation and series resistance correction are essential

  • Analysis approach:

    • Single-channel conductance measurements

    • Open probability vs. membrane tension calculations

    • Dwell time analysis for kinetic characterization

Based on previous MscL studies, a progressive pressure protocol starting from 0 mmHg with 10 mmHg increments, holding for 30 seconds at each pressure level, allows for detailed characterization of channel opening thresholds and kinetics. This approach has successfully demonstrated differences in gating sensitivity between wild-type MscL and N-terminal deletion mutants, with constructs like Δ2–7 showing severe loss of sensitivity and requiring considerably more force to gate .

What approaches can distinguish between effects of mutations on channel structure versus membrane coupling?

Distinguishing between mutation effects on channel structure versus membrane coupling represents a significant challenge in mscL research. A comprehensive approach requires multiple complementary techniques:

  • Structural assessment strategies:

    • Circular dichroism (CD) spectroscopy to detect changes in secondary structure

    • Size exclusion chromatography to assess oligomeric state changes

    • Molecular dynamics simulations to predict structural perturbations

    • Chemical cross-linking to probe inter-subunit interactions

  • Membrane interaction techniques:

    • Fluorescence resonance energy transfer (FRET) between channel residues and membrane probes

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to measure mobility parameters of specific residues, similar to approaches used to measure mobility at position M94-SL in MscL

    • Tryptophan fluorescence to assess hydrophobic interactions

    • Lipid binding assays with varying head groups and acyl chains

  • Functional correlation analysis:

    • Compare mobility parameters with functional measurements

    • Establish force-response curves across mutations

    • Analyze activation kinetics under varying membrane compositions

A systematic approach would combine site-directed mutagenesis of the N-terminal region with both structural and functional assays. For example, research on the N-terminal helix of MscL showed that deletion mutants (Δ2–7) exhibited both structural changes (increased mobility at position M94-SL) and functional effects (increased force required for gating), suggesting this region's dual role in structure stabilization and membrane coupling .

How does the N-terminal region of S. proteamaculans mscL influence channel gating behavior?

The N-terminal region of mechanosensitive channels plays a crucial role in gating behavior, with research on MscL channels providing valuable insights:

  • Structural role: The amphipathic N-terminal helix of MscL has been demonstrated to act as a crucial structural element during tension-induced gating . It stabilizes the closed state of the channel while simultaneously coupling the channel to the membrane .

  • Deletion effects: Studies with N-terminal deletion constructs have shown that:

    • Deletion of more than five residues from the N-terminus leads to a sharp increase in mobility of TM2 (transmembrane domain 2)

    • The most severe loss of sensitivity to membrane tension occurs with Δ2–7 constructs

    • All N-terminal deletion constructs require considerably more force to gate when assessed using patch-clamp electrophysiology

  • Intersubunit interactions: The N-terminus of one subunit (i) comes within close proximity of TM2 of the second-next neighboring channel subunit (i+2), suggesting an important role in maintaining the closed-state stability through intersubunit contacts .

  • Membrane coupling mechanism: The amphipathic nature of the N-terminal helix allows it to interact with the membrane-water interface, potentially serving as a tension sensor that triggers conformational changes upon membrane deformation.

Based on these findings from MscL research, the N-terminal region of S. proteamaculans mscL would likely play a similar dual role in both structural stabilization and mechanosensation. A systematic mutagenesis approach targeting the amphipathic characteristics (hydrophobicity, charge distribution) of this region would help elucidate its specific contributions to S. proteamaculans mscL gating behavior.

What methodologies are most effective for comparing mscL channels across different bacterial species?

Comparative analysis of mscL channels from different bacterial species, including S. proteamaculans, requires a multi-faceted approach:

  • Sequence-based analyses:

    • Multiple sequence alignment to identify conserved regions

    • Phylogenetic analysis to establish evolutionary relationships

    • Conservation scoring of functional domains

    • Coevolution analysis to identify coupled residues

  • Structural comparison approaches:

    • Homology modeling based on existing crystal structures

    • Molecular dynamics simulations under standardized conditions

    • Comparative analysis of secondary structure elements

    • Conservation mapping onto three-dimensional structures

  • Standardized functional assays:

    • Reconstitution into identical lipid environments

    • Patch-clamp electrophysiology with consistent protocols

    • Pressure sensitivity profiles under comparable conditions

    • Single-channel conductance and ion selectivity measurements

  • Chimeric protein strategies:

    • Domain swapping between different bacterial mscL homologs

    • Creation of chimeric channels with mixed structural elements

    • Systematic replacement of key regions (N-terminus, TM domains)

    • Functional characterization of chimeric constructs

When comparing S. proteamaculans mscL with other bacterial homologs, particular attention should be paid to the N-terminal region, as it has been established as a critical element for tension-induced gating in MscL channels . Experimental designs should include standardized patch-clamp protocols that measure both the pressure threshold required for activation and the pressure-response relationship, enabling quantitative comparison across species.

How can molecular dynamics simulations enhance understanding of mscL gating mechanisms?

Molecular dynamics (MD) simulations provide powerful insights into mscL gating mechanisms that are difficult to obtain experimentally:

  • Simulation setup considerations:

    • Explicit membrane representation with physiologically relevant lipid compositions

    • Sufficient system size to avoid boundary effects (typically >100,000 atoms)

    • Microsecond-scale simulations to capture relevant conformational changes

    • Appropriate force fields validated for membrane protein simulations

  • Tension application methods:

    • Surface tension approaches that modify the lateral pressure profile

    • Steered MD with application of forces to specific residues

    • Constant area simulations with incremental expansion

    • Coarse-grained approaches for extended time scales

  • Analysis techniques:

    • Transmembrane domain movement tracking

    • Pore radius calculations along the channel axis

    • Water permeation and ion conductance measurements

    • Hydrogen bond network analysis

    • Lipid-protein interaction mapping

  • Validation approaches:

    • Comparison with experimental EPR mobility parameters

    • Correlation with electrophysiological gating thresholds

    • Testing predictions through site-directed mutagenesis

MD simulations would be particularly valuable for understanding the role of the N-terminal region in S. proteamaculans mscL, as this region has been experimentally demonstrated to be crucial in MscL gating . Simulations could reveal how the amphipathic N-terminal helix interacts with the membrane and transmits tension to the channel pore, potentially identifying species-specific mechanisms.

What statistical approaches are appropriate for analyzing mscL electrophysiological data?

Analysis of electrophysiological data from mscL channels requires robust statistical approaches to account for the inherent variability in biological systems:

  • Appropriate experimental design:

    • Latin Square Design (LSD) is particularly valuable when controlling for multiple factors

    • This design eliminates two sources of variation (rows and columns) from the experimental error

    • For mscL studies, this could control for variations in membrane preparation and recording conditions

  • Single-channel analysis:

    • Dwell time distributions require maximum likelihood fitting rather than simple histograms

    • Markov models should be validated using Bayesian Information Criterion (BIC) or Akaike Information Criterion (AIC)

    • Bootstrap resampling provides robust confidence intervals

    • Idealization algorithms should be validated with simulated data

  • Pressure-response relationships:

    • Boltzmann function fitting with appropriate weighting

    • Comparison of midpoint pressures (P₅₀) using paired statistical tests

    • Analysis of slope factors to detect changes in gating cooperativity

    • Careful handling of censored data (channels that don't open at maximum pressure)

  • Multi-level models for nested data:

    • Account for patch-to-patch and day-to-day variability

    • Include random effects for experimental batches

    • Consider hierarchical Bayesian approaches for complex datasets

  • Visualization approaches:

    • Kernel density estimation for continuous distributions

    • Box plots showing individual data points

    • Q-Q plots to assess normality

    • Forest plots for meta-analysis across experiments

When analyzing N-terminal deletion mutants, statistical approaches should account for possible correlations between mobility parameters and gating thresholds, as observed in MscL studies where increased mobility at specific positions corresponded with increased force requirements for gating .

How should contradictory results in mscL functional assays be investigated and resolved?

Contradictory results in mscL functional assays are not uncommon due to the complexity of membrane protein systems. A systematic troubleshooting approach includes:

  • Technical variation assessment:

    • Standardize protein expression and purification protocols

    • Verify protein quality by multiple methods (SDS-PAGE, Western blot, mass spectrometry)

    • Control membrane composition precisely in reconstitution experiments

    • Calibrate pressure application systems regularly

  • Biological variability investigation:

    • Consider post-translational modifications

    • Assess oligomeric state heterogeneity

    • Check for lipid co-purification differences

    • Evaluate expression level variations

  • Methodological comparison:

    • Cross-validate using different functional assays:

      • Patch-clamp electrophysiology

      • Calcein release assays

      • In vivo osmotic downshock protection

    • Compare results across different membrane environments

  • Statistical reanalysis:

    • Perform power analysis to ensure adequate sample sizes

    • Consider using more robust statistical methods

    • Evaluate outlier identification criteria

    • Meta-analysis of multiple experiments

  • Experimental design revision:

    • Implement Latin Square Design to control for multiple sources of variation

    • Add additional control conditions

    • Blind the experimenter to sample identity

    • Pre-register experimental protocols and analysis plans

When investigating contradictions in N-terminal functional effects, researchers should consider the dual role this region plays in both structural stabilization and membrane coupling . Different assay conditions may emphasize one role over the other, potentially explaining seemingly contradictory results.

What are the key considerations for designing structure-function relationship studies of recombinant mscL?

Designing robust structure-function relationship studies for recombinant mscL channels requires careful consideration of multiple factors:

  • Mutation strategy planning:

    • Alanine scanning of entire functional domains

    • Charge reversal to test electrostatic interactions

    • Conservative substitutions to probe specific interactions

    • Cysteine scanning for accessibility studies

    • Systematic deletion series, particularly in the N-terminal region shown to be critical for function

  • Structural impact assessment:

    • Circular dichroism (CD) to confirm secondary structure preservation

    • Size exclusion chromatography to verify oligomeric state

    • Thermal stability measurements to detect destabilization

    • Site-directed spin labeling with EPR to measure mobility parameters at specific positions

  • Functional characterization standardization:

    • Consistent membrane composition across all constructs

    • Standardized pressure application protocols

    • Multiple independent preparations for each construct

    • Paired wild-type controls in each experimental session

  • Correlation analysis approaches:

    • Plotting structure parameters against functional measurements

    • Multiple regression to identify key determinants

    • Principal component analysis to reduce dimensionality

    • Cluster analysis to identify functional groupings

  • Validation through convergent approaches:

    • Computational predictions tested by experimental mutations

    • Cross-species conservation analysis to support functional importance

    • Rescue experiments to confirm specific interaction hypotheses

    • Second-site suppressor mutations to validate mechanistic models

Following these guidelines would enable robust investigation of critical questions such as the role of the N-terminal amphipathic helix in channel gating, which has been demonstrated to act as a crucial structural element during tension-induced gating in MscL channels .

How can comparative studies between S. proteamaculans mscL and other bacterial mechanosensitive channels advance our understanding of mechanosensation?

Comparative studies between S. proteamaculans mscL and other bacterial mechanosensitive channels offer unique opportunities to uncover fundamental principles of mechanosensation:

  • Evolutionary insights:

    • Phylogenetic analysis of mscL sequences across diverse bacterial species

    • Correlation of channel properties with ecological niches (S. proteamaculans is widely distributed in nature and frequently isolated from insect gut microbiota)

    • Identification of conserved versus variable regions as indicators of functional importance

  • Structure-function correlation across species:

    • Comparative analysis of N-terminal regions, which have been shown to be crucial for MscL function

    • Mapping of species-specific differences onto structural models

    • Identification of compensatory mutations that maintain function despite sequence divergence

  • Mechanistic conservation assessment:

    • Comparison of gating thresholds and kinetics across homologs

    • Evaluation of lipid sensitivity patterns between species

    • Investigation of whether the amphipathic N-terminal helix plays a similar dual role (stabilizing closed state and coupling to membrane) across species

  • Chimeric channel approaches:

    • Systematic domain swapping between S. proteamaculans mscL and well-characterized homologs

    • Functional characterization of chimeric constructs to identify regions responsible for species-specific properties

    • Engineering of channels with novel properties based on insights from multiple species

These comparative studies would contribute significantly to establishing whether the role of the N-terminal helix as a crucial structural element during tension-induced gating represents a common principle in mechanosensory transduction across different bacterial species .

What technological advances would most benefit research on recombinant mechanosensitive channels?

Several technological advances would significantly benefit research on recombinant mechanosensitive channels including S. proteamaculans mscL:

  • High-throughput electrophysiology platforms:

    • Automated patch-clamp systems adapted for mechanosensitive channels

    • Microfluidic devices with integrated pressure control

    • Parallel recording capabilities for multiple conditions

    • Real-time analysis algorithms for immediate feedback

  • Advanced imaging technologies:

    • High-speed atomic force microscopy for direct visualization of conformational changes

    • Super-resolution fluorescence microscopy of labeled channels in native-like membranes

    • Cryo-electron microscopy approaches for capturing intermediate states

    • Correlative light and electron microscopy for contextualized structural information

  • Membrane mimetic systems:

    • Nanodiscs with precisely controlled lipid compositions

    • Droplet interface bilayers for rapid composition screening

    • Polymer-supported membranes with adjustable mechanical properties

    • Cell-derived giant plasma membrane vesicles for near-native environments

  • Computational methodologies:

    • Enhanced sampling techniques for faster exploration of conformational space

    • Machine learning approaches for predicting functional properties from sequence

    • Quantum mechanical/molecular mechanical (QM/MM) methods for studying key interactions

    • Multiscale modeling linking molecular dynamics to continuum mechanics

  • Genetic and molecular biology tools:

    • CRISPR-based genome editing for precise chromosomal integration

    • Cell-free expression systems optimized for membrane proteins

    • Unnatural amino acid incorporation for site-specific probes

    • High-throughput mutagenesis and functional screening platforms

These technological advances would enable more detailed investigation of critical questions such as how the amphipathic N-terminal helix of mscL couples membrane mechanics to channel gating, a mechanism that may represent a common principle in mechanosensory transduction .

How can insights from bacterial mscL research contribute to understanding mechanosensation in higher organisms?

Research on bacterial mechanosensitive channels, including S. proteamaculans mscL, provides valuable insights that extend to mechanosensation in higher organisms:

  • Fundamental mechanistic principles:

    • The role of amphipathic helices in sensing membrane deformation, as demonstrated in MscL studies , may represent a conserved mechanism across evolution

    • Understanding how the N-terminal region couples membrane tension to conformational changes in bacterial channels could inform models of eukaryotic mechanosensitive channel function

    • The demonstration that mechanical force can be transmitted directly from the lipid bilayer to the channel protein established a paradigm relevant to multiple mechanosensory systems

  • Structural motifs and functional domains:

    • Identification of structural elements crucial for mechanosensation in bacterial channels provides search templates for analogous regions in eukaryotic channels

    • The dual role of the MscL N-terminal region in both structural stabilization and membrane coupling suggests similar multifunctional domains may exist in eukaryotic mechanosensors

  • Membrane-protein interactions:

    • Bacterial channel studies have revealed the importance of specific lipid-protein interactions in mechanosensation

    • These principles inform investigation of lipid regulation of mechanosensitive channels in eukaryotes

    • The coupling of channel conformation to membrane dynamics observed in MscL likely applies to eukaryotic channels as well

  • Experimental methodology transfer:

    • Techniques developed for bacterial channel characterization (patch-clamp protocols, tension calibration, reconstitution systems) are directly applicable to eukaryotic channel studies

    • Computational approaches validated with bacterial systems provide templates for eukaryotic channel modeling

These cross-kingdom insights are particularly valuable because the biophysical principles of mechanosensation are likely conserved despite differences in molecular implementation, making bacterial mscL research an important foundation for understanding more complex mechanosensory systems.

What are the current gaps in knowledge regarding S. proteamaculans mscL that represent high-priority research opportunities?

Despite advances in mechanosensitive channel research, several knowledge gaps regarding S. proteamaculans mscL represent significant research opportunities:

  • Basic characterization:

    • The complete sequence, structure, and functional properties of S. proteamaculans mscL remain to be fully characterized

    • Understanding how its properties relate to the ecological niche of S. proteamaculans, which is widely distributed in nature and frequently isolated from insect gut microbiota

    • Determining whether its laccase production capabilities and mscL function have any physiological relationship

  • Comparative aspects:

    • How S. proteamaculans mscL differs from well-characterized homologs in terms of tension sensitivity, conductance, and ion selectivity

    • Whether the N-terminal region plays the same crucial structural role as demonstrated in other MscL channels

    • If species-specific differences correlate with environmental adaptations

  • Molecular mechanism:

    • Detailed understanding of how the amphipathic N-terminal helix of S. proteamaculans mscL contributes to both structural stabilization and membrane coupling

    • Identification of key residues involved in intersubunit contacts, similar to the proximity observed between the N-terminus of one subunit and TM2 of the i+2 subunit in other MscL channels

    • Characterization of the mobility parameters of specific residues under various conditions, comparable to studies measuring mobility at position M94-SL in other MscL channels

  • Technical challenges:

    • Development of optimized expression and purification protocols specifically for S. proteamaculans mscL

    • Establishment of reliable reconstitution systems that maintain native-like function

    • Creation of standardized assay conditions for comparative studies

Addressing these knowledge gaps would significantly advance our understanding of bacterial mechanosensation and potentially reveal species-specific adaptations that contribute to the remarkable environmental versatility of S. proteamaculans .

What methodological best practices should researchers follow to ensure reproducible results in mscL studies?

To ensure reproducible results in mscL studies, researchers should adhere to the following methodological best practices:

  • Experimental design considerations:

    • Implement Latin Square Design or other appropriate design strategies to control for multiple sources of variation

    • Pre-register experimental protocols and analysis plans

    • Include all relevant controls in each experimental session

    • Ensure adequate statistical power through appropriate sample size calculations

  • Protein expression and purification:

    • Document complete protocols including strain information, growth conditions, and buffer compositions

    • Verify protein purity by multiple methods (SDS-PAGE, mass spectrometry)

    • Characterize protein oligomeric state and homogeneity

    • Assess batch-to-batch variability with standardized quality control assays

  • Membrane environment standardization:

    • Precisely control lipid compositions in reconstitution experiments

    • Document all aspects of membrane preparation procedures

    • Verify incorporation efficiency and orientation

    • Characterize physical properties of resulting membranes

  • Electrophysiological measurements:

    • Calibrate pressure application systems regularly

    • Document patch pipette specifications and fabrication procedures

    • Standardize analysis parameters for channel identification and characterization

    • Report all technical parameters (filtering, sampling rate, series resistance compensation)

  • Data analysis transparency:

    • Share raw data in community repositories

    • Provide analysis code and clearly document all steps

    • Report all exclusion criteria and number of technical and biological replicates

    • Clearly distinguish between exploratory and confirmatory analyses

  • Mutation studies considerations:

    • Verify expression levels of all mutant constructs

    • Confirm proper folding and membrane insertion

    • Include restoration-of-function experiments for key findings

    • Consider compensatory effects in multiple mutation studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.