Recombinant Serratia proteamaculans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Lipoprotein Signal Peptidase (LspA)

Lipoprotein signal peptidase (LspA) is a critical enzyme in bacterial lipoprotein biosynthesis. It catalyzes the cleavage of signal peptides from diacylglyceryl-modified prolipoproteins, enabling mature lipoprotein transport to cellular membranes . In Gram-negative bacteria like Serratia proteamaculans, LspA is essential for processing lipoproteins involved in virulence, nutrient acquisition, and antibiotic resistance .

Key characteristics of LspA:

  • Function: Aspartyl endopeptidase activity targeting the lipobox motif ([LVI][ASTVI][GAS]C) .

  • Localization: Inner membrane-associated .

  • Inhibition: Targeted by antibiotics like globomycin and myxovirescin .

Genomic Context of lspA in Serratia proteamaculans

While S. proteamaculans genomes encode numerous lipoproteins linked to pathogenicity , direct characterization of its lspA gene remains limited. Comparative genomic analyses reveal:

FeatureS. proteamaculansEscherichia coliAcinetobacter baumannii
Lipoprotein count>90 ~100 >90
LspA homologs1 (putative)12
Resistance mechanismsUncharacterizedlpp deletion lirL mutations

S. proteamaculans shares conserved lipoprotein biosynthesis pathways with other Enterobacteriaceae, but species-specific adaptations likely exist .

Recombinant Expression and Biochemical Properties

  • Expression systems: Heterologous expression in E. coli is common for bacterial signal peptidases .

  • Enzyme kinetics:

    • E. coli LspA: K<sub>m</sub> = 2.4 μM (globomycin inhibition IC<sub>50</sub> = 0.8 μM) .

    • A. baumannii LspA: Reduced inhibitor potency compared to E. coli .

Role in Bacterial Physiology and Pathogenesis

Although direct evidence in S. proteamaculans is lacking, LspA contributes to virulence in related pathogens:

  • Virulence linkage:

    • LspA-processed lipoproteins mediate adhesion, immune evasion, and toxin secretion .

    • In S. proteamaculans, protealysin (a metalloprotease) requires lipoprotein transport systems for secretion .

  • Antibiotic resistance:

    • Mutations in lipoprotein genes (e.g., lirL in A. baumannii) confer resistance to LspA inhibitors .

    • S. proteamaculans exhibits β-lactamase activity via AmpC, though its relationship with LspA remains unstudied .

Therapeutic Targeting Potential

LspA inhibitors show promise against multidrug-resistant pathogens:

InhibitorTarget BacteriaMIC ReductionResistance Mechanism
GlobomycinE. coli, A. baumannii64-fold lpp deletion
G5132A. baumannii4× MIC Signal peptide mutations

For S. proteamaculans, developing LspA-targeted therapies could counteract its seafood spoilage capabilities and opportunistic infections .

Research Gaps and Future Directions

  1. Functional characterization: Heterologous expression and crystallography of S. proteamaculans LspA.

  2. Inhibitor screens: Evaluate globomycin analogs against recombinant enzymes.

  3. Pathogenicity studies: Link lspA activity to protealysin secretion or biofilm formation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference for your own protocols.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize fulfilling your requirements.
Synonyms
lspA; Spro_0699; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
lspA
Target Protein Sequence
MSKPICSTGLRWLWLVVVVLVLDFASKQWILGNFVLGQSQPLIPSFNLFYARNYGAAFSF LADHGGWQRWFFAGIAVAIVAVLLVMMYRSSAQQKLNNIAYAFIIGGALGNLFDRLWHGF VVDFIDFYVGNWHYPTFNLADSFICVGAAMIVLEGFLSPANKSAKSKGE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (LspA) and what is its role in bacterial physiology?

LspA is an aspartyl protease that performs the second step in the lipoprotein processing pathway, specifically cleaving the transmembrane helix signal peptide of lipoproteins after lipidation by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt) . This enzyme is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria. In the complete lipoprotein processing pathway, after diacylation of the substrate cysteine by Lgt, LspA cleaves the signal peptide from the substrate, and then in Gram-negative bacteria, Lnt N-acylates the lipid modification of the substrate .

Lipoproteins themselves perform a wide range of crucial bacterial functions including signal transduction, stress sensing, virulence, cell division, nutrient uptake, and adhesion . Properly processed lipoproteins are also important in triggering host immune responses during infection .

What are the key structural elements of bacterial LspA proteins?

Based on structural studies of LspA from other bacterial species, key structural elements include:

  • A β-cradle structure that forms part of the active site

  • A periplasmic helix (PH) that participates in substrate binding and catalysis

  • A catalytic dyad consisting of conserved aspartate residues

  • At least 14 additional highly conserved residues surrounding the active site

  • A clamp-like mechanism formed by the β-cradle and periplasmic helix that allows substrate binding and processing

Why is recombinant S. proteamaculans LspA of particular interest to researchers?

S. proteamaculans LspA, like other bacterial LspA enzymes, is of significant research interest because:

  • Enzymes in the lipoprotein processing pathway are found universally across bacterial species

  • They are essential in many pathogenic organisms

  • They have no mammalian homologs, making them excellent antibiotic targets

  • The essential nature of LspA may limit development of resistance to therapeutics targeting it

  • Inhibition of LspA disrupts multiple bacterial functions dependent on properly processed lipoproteins

What are the recommended protocols for cloning and expressing recombinant S. proteamaculans LspA?

Based on methods established for other bacterial LspA proteins, the recommended approach is:

  • PCR amplification of the complete lspA gene using primers with appropriate restriction sites (commonly BamHI and EcoRI)

  • Cloning into an expression vector with an inducible promoter (lac, trc, or T7)

  • Adding a purification tag (such as N-terminal His₆) to facilitate purification

  • Confirming the constructed plasmid by sequencing

  • Transforming into an E. coli expression strain (e.g., Top10, BL21(DE3) or specialized strains for membrane proteins)

For expression:

  • Grow cultures to mid-log phase before induction

  • Induce with appropriate concentration of IPTG

  • Lower expression temperature (16-25°C) to promote proper folding

  • Express for 4-16 hours depending on construct stability

What purification strategies yield the highest purity and activity for recombinant LspA?

A detailed purification protocol based on methods successful with other LspA proteins:

  • Harvest cells and resuspend in buffer (typically Tris or phosphate-based with NaCl)

  • Disrupt cells using sonication or mechanical methods

  • Separate the membrane fraction by ultracentrifugation (100,000g for 45 min)

  • Solubilize membrane proteins using FC12 detergent at 1.8% (w/v)

  • Remove unsolubilized material by ultracentrifugation

  • Purify using immobilized metal affinity chromatography if His-tagged

  • Apply the solubilized protein to a Ni²⁺ column and wash with buffer containing 40 mM imidazole and 0.14% (w/v) FC12

  • Elute with buffer containing 300 mM imidazole and 0.14% (w/v) FC12

  • Remove imidazole using size exclusion chromatography or a PD-10 column

  • Concentrate to desired concentration using a 10 kDa molecular weight cutoff concentrator

  • Confirm protein purity by SDS-PAGE and identity by mass spectrometry

Purification StepBuffer CompositionCritical Parameters
Membrane ExtractionBuffer A + 1.8% (w/v) FC12Rock at 4°C for ≥1 hour
IMAC BindingBuffer A + 0.14% (w/v) FC12Flow rate: 0.5-1 ml/min
IMAC WashBuffer A + 40 mM imidazole + 0.14% (w/v) FC12≥10 column volumes
IMAC ElutionBuffer A + 300 mM imidazole + 0.14% (w/v) FC12Collect 0.5-1 ml fractions
Buffer ExchangeBuffer A + 0.14% (w/v) FC12Remove imidazole completely

*Buffer A typically contains 50 mM Tris-HCl pH 8.0, 300 mM NaCl

How do the conformational dynamics of LspA influence its catalytic function?

LspA undergoes significant conformational changes essential for its function:

  • The periplasmic helix (PH) fluctuates on the nanosecond timescale and samples multiple distinct conformations

  • In the apo (unbound) state, the dominant conformation is the most closed, where the β-cradle and PH are approximately 6.2 Å apart

  • This closed conformation occludes the charged active site residues from the lipid bilayer, protecting them from the hydrophobic environment

  • When antibiotic or substrate is bound, the PH adopts a more open conformation

  • The most open conformation creates a trigonal cavity where the lipoprotein substrate can enter and bind

These dynamics explain how LspA accommodates and processes various substrates. The protein exists in an equilibrium between states, with different populations of each conformation depending on whether the enzyme is in the apo state or bound to substrate/inhibitor .

What experimental approaches can be used to study the conformational states of recombinant S. proteamaculans LspA?

A hybrid experimental approach combining multiple techniques provides the most comprehensive understanding:

Molecular Dynamics (MD) Simulations:

  • Run triplicate simulations of at least 500 ns each in both apo and bound states

  • Embed the protein model in a lipid bilayer using coarse-grained simulations first (200+ ns)

  • Convert to all-atom representations for production simulations

  • Analyze root mean squared fluctuation (RMSF) to identify regions with highest mobility

  • Select structures from trajectories that match experimental data for visualization

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Introduce cysteine residues at strategic positions through site-directed mutagenesis

  • Label with MTSL spin label

  • Perform continuous-wave (CW) EPR to analyze local mobility

  • Conduct double electron-electron resonance (DEER) to measure distances between labeled sites

  • Compare distance distributions in different functional states (apo vs. inhibitor-bound)

The combination of these approaches has successfully revealed conformational states not observed in crystal structures alone, providing crucial insights into LspA function .

How does substrate specificity of LspA compare across bacterial species?

While specific comparative data for S. proteamaculans LspA isn't available in the search results, general principles can be inferred:

  • LspA must accommodate diverse lipoprotein signal sequences across numerous bacterial substrates

  • The flexible periplasmic helix allows adaptation to different substrates

  • The enzyme maintains specificity for the diacylglyceryl-modified cysteine motif common to all bacterial lipoproteins

  • Variations in amino acid sequence surrounding the conserved catalytic residues may influence substrate preference

A recommended comparative analysis would include:

  • Sequence alignment of LspA across diverse bacterial species

  • Homology modeling based on available crystal structures

  • Docking studies with model substrates

  • Experimental comparison of cleavage efficiency using standardized synthetic peptides

How can molecular dynamics simulations be optimized for studying S. proteamaculans LspA?

Detailed MD simulation protocol based on successful approaches with LspA:

  • System Preparation:

    • Create a homology model of S. proteamaculans LspA based on P. aeruginosa LspA (PDB: 5DIR)

    • Embed in a lipid bilayer that mimics bacterial membrane composition

    • Solvate the system and add ions to neutralize and achieve physiological concentration

  • Simulation Parameters:

    • Use GROMACS software package

    • Apply Martini 2.2 force field for coarse-grained preparation simulations

    • For all-atom simulations, use CHARMM36 force field with TIP3P water model

    • Perform initial 200 ns coarse-grained simulation to allow proper membrane assembly

    • Convert to all-atom representation for production runs

  • Production Simulations:

    • Run 500+ ns simulations in triplicate for statistical significance

    • Simulate both apo and ligand-bound states

    • Remove position restraints completely during production phase

    • Use appropriate parameters for ligands (generated via CHARMM-GUI webserver)

  • Analysis Focus:

    • Monitor RMSF to identify highly mobile regions

    • Track distances between the periplasmic helix and β-cradle

    • Conduct principal component analysis to identify dominant motions

    • Select representative structures for visualization and comparison with experimental data

How should EPR experiments be designed to characterize the dynamics of S. proteamaculans LspA?

Comprehensive EPR experimental design:

  • Site Selection for Spin Labeling:

    • Introduce single cysteine mutations at strategic positions:

      • The periplasmic helix (residues corresponding to positions 59-63 in P. aeruginosa LspA)

      • The β-cradle (particularly the last β-turn, residues corresponding to 130-134)

      • Positions that can detect opening/closing of the active site

  • Protein Preparation:

    • Express and purify cysteine mutants using the established protocol

    • Label with MTSL spin label by incubating with 0.7 mM MTSL overnight at 4°C

    • Remove excess label by column washing

    • Prepare samples in FC12 detergent micelles at appropriate concentration

  • CW EPR Measurements:

    • Perform at room temperature using X-Band spectrometer

    • Load samples into 0.6 mm glass capillary tubes

    • Compare spectra between apo state and inhibitor/substrate-bound states

    • Analyze for changes in mobility that indicate conformational changes

  • DEER EPR for Distance Measurements:

    • Create double cysteine mutants to measure distances between domains

    • Perform measurements at cryogenic temperatures

    • Extract distance distributions to identify populated conformational states

    • Compare distributions between functional states

  • Controls and Validations:

    • Test effect of solvent conditions (e.g., DMSO disrupts structure)

    • Create control mutants to verify spin label does not perturb function

    • Validate findings against MD simulation predictions

What approaches can be used to monitor LspA expression levels during bacterial growth?

Based on studies of LspA in other bacteria, a comprehensive approach includes:

  • Real-time Quantitative RT-PCR (qRT-PCR):

    • Design primers specific to S. proteamaculans lspA

    • Extract RNA at various time points during bacterial growth

    • Use two-step qRT-PCR protocol as established for other bacterial species

    • Normalize expression to appropriate housekeeping genes

    • Compare with other genes in the lipoprotein processing pathway (lgt, lepB)

  • Expression Pattern Analysis:

    • Monitor from pre-infection/early growth through stationary phase

    • Observe the characteristic pattern: initial higher expression followed by decrease until exponential growth phase, then increase peaking at mid-to-late log phase, and finally decrease during stationary phase

    • Compare expression kinetics with related genes like lgt (encoding prolipoprotein diacylglyceryl transferase) and lepB (encoding SPase I)

  • Protein-level Confirmation:

    • Use Western blot with specific antibodies or epitope tags

    • Quantify protein levels at different growth stages

    • Correlate with transcriptional data

Growth PhaseExpected lspA ExpressionCorrelation with Other Genes
Early/Pre-infectionHigh initial level, then decreasesSimilar pattern to lgt
Early Log (≤8h)Lowest expressionSimilar to lgt, lower than lepB
Mid-Log (24-48h)Increasing, peaks at ~48hParallels lgt expression
Late Log/Stationary (>48h)Decreases as cells reach stationary phaseSimilar decrease in lgt and lepB

Why is LspA considered a promising target for antibiotic development?

LspA represents an attractive antibiotic target for multiple reasons:

  • Essential Role:

    • Essential in Gram-negative bacteria like E. coli and S. enterica

    • Important for virulence in Gram-positive bacteria

    • Disruption compromises vital bacterial functions

  • Structural and Functional Uniqueness:

    • No mammalian homologs, reducing potential off-target effects

    • Conserved across the bacterial phylogenetic tree

    • Performs a specialized function in lipoprotein processing

  • Demonstrated Drugability:

    • Natural product inhibitors (globomycin, myxovirescin) already identified

    • Crystal structures with bound inhibitors provide templates for drug design

    • Multiple binding modes for inhibitors demonstrated

  • Resistance Considerations:

    • May have lower propensity for resistance development due to essential nature

    • Target site is highly conserved, constraining viable mutations

How do known inhibitors like globomycin interact with LspA?

Globomycin's mechanism of action with LspA has been characterized:

  • Binding Mechanism:

    • Binds in the active site near the catalytic dyad residues

    • Can adopt different orientations while maintaining similar interactions with the catalytic residues

    • Stabilizes an intermediate conformation of the periplasmic helix

  • Conformational Effects:

    • When bound to globomycin, LspA's periplasmic helix adopts a more open conformation compared to the apo state

    • This prevents the enzyme from achieving either the fully closed state (which protects the active site) or the fully open state (which allows substrate binding)

    • Multiple binding modes exist with the dominant conformation having the periplasmic helix in a more open position

  • Inhibitory Mechanism:

    • Blocks substrate binding by occupying the active site

    • Prevents the conformational changes needed for catalysis

    • Effectively traps the enzyme in a non-functional state

What experimental approaches can determine if a compound is an effective inhibitor of S. proteamaculans LspA?

A comprehensive approach to evaluating potential LspA inhibitors:

  • In vitro Binding and Inhibition Assays:

    • Determine binding affinity using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

    • Measure inhibition of enzymatic activity using synthetic peptide substrates

    • Calculate IC50 values and compare with established inhibitors like globomycin

  • Structural Studies:

    • Obtain co-crystal structures of LspA with inhibitor bound

    • Use EPR spectroscopy to determine if the inhibitor induces similar conformational changes as globomycin

    • Perform MD simulations to model binding modes and conformational effects

  • Bacterial Growth Inhibition:

    • Test growth inhibition in wild-type and LspA-overexpressing strains

    • Confirm target specificity by testing against strains with modified LspA (mutations in binding site)

    • Evaluate synergy with other antibiotics

  • Lipoprotein Processing Analysis:

    • Monitor accumulation of unprocessed prolipoproteins by Western blotting

    • Assess effects on bacterial membrane integrity and function

    • Evaluate impact on virulence factor expression and secretion

What are common difficulties in expressing and purifying functional recombinant LspA?

Common challenges and recommended solutions:

  • Low Expression Levels:

    • Optimize codon usage for expression host

    • Test different E. coli strains specialized for membrane proteins

    • Reduce expression temperature to 16-20°C

    • Use stronger ribosome binding sites or optimize promoter strength

  • Protein Misfolding and Aggregation:

    • Add protein stabilizers (glycerol, specific lipids) to growth media

    • Co-express with chaperones

    • Use mild solubilization conditions

    • Screen various detergents beyond FC12, such as DDM or LDAO

  • Detergent Selection Issues:

    • FC12 at 1.8% for extraction and 0.14% for purification is a good starting point

    • If protein is unstable, test gentler detergents or lipid nanodiscs

    • Assess protein quality using size exclusion chromatography to confirm monodispersity

    • Include cholesterol or specific phospholipids if needed for stability

  • Purification Challenges:

    • Use step gradients instead of linear gradients for elution

    • Include protease inhibitors throughout purification

    • Maintain strict temperature control (4°C)

    • Concentrate protein slowly to avoid aggregation

How can researchers troubleshoot EPR experiments with recombinant LspA?

EPR troubleshooting strategies:

  • Poor Labeling Efficiency:

    • Ensure complete reduction of cysteine residues before labeling

    • Optimize labeling time and temperature

    • Verify cysteine accessibility in the protein structure

    • Try alternative spin labels if MTSL is inefficient

  • Complex or Uninterpretable Spectra:

    • Check for sample aggregation by gel filtration or dynamic light scattering

    • Ensure detergent concentration is above CMC but not so high it interferes

    • Control for non-specific labeling with a cysteine-free control

    • Test the effect of different solvents, as even DMSO can disrupt structure

  • No Observable Conformational Changes:

    • Verify inhibitor binding by complementary methods

    • Choose alternative labeling positions

    • Consider that some positions may not detect the relevant motion

    • Use double mutants to monitor different distances

  • Technical EPR Issues:

    • For CW EPR, optimize microwave power and modulation amplitude

    • For DEER, extend dipolar evolution time to capture longer distances

    • Increase sample concentration or number of scans for better signal-to-noise

    • Consider Q-band instead of X-band for improved sensitivity

What contradictions might arise when comparing S. proteamaculans LspA data with other species, and how should they be resolved?

Potential contradictions and resolution approaches:

  • Sequence and Structural Differences:

    • Perform thorough sequence alignments focusing on conserved functional regions

    • Create homology models to visualize structural differences

    • Map variations onto structural models to assess potential functional impacts

    • Consider evolutionary relationships between species when interpreting differences

  • Discrepancies in Inhibitor Sensitivity:

    • Test multiple inhibitors under identical conditions

    • Determine structure-activity relationships specific to each species

    • Identify amino acid differences in binding sites that could explain differential sensitivity

    • Perform mutagenesis to convert residues to match other species and test effect

  • Expression Pattern Variations:

    • Standardize growth conditions when comparing across species

    • Consider ecological niches of different bacteria and how they might influence regulation

    • Examine upstream regulatory regions for differences in promoter elements

    • Create chimeric constructs to identify which regions drive expression differences

  • Methodological Inconsistencies:

    • Ensure identical experimental conditions when comparing across species

    • Use multiple complementary techniques to verify findings

    • Include well-characterized homologs as benchmarks

    • Consider how membrane composition differences might affect protein behavior

What are promising approaches for designing selective inhibitors of S. proteamaculans LspA?

Strategic approaches for inhibitor development:

  • Structure-Based Design:

    • Create a detailed homology model of S. proteamaculans LspA

    • Target the three distinct conformational states identified through MD and EPR

    • Design compounds that lock the enzyme in non-functional conformations

    • Focus on compounds that mimic the transition state of the catalytic reaction

  • Targeting Conformational Dynamics:

    • Design inhibitors that specifically disrupt the dynamic equilibrium between states

    • Target the periplasmic helix, which shows the greatest flexibility

    • Develop allosteric inhibitors that bind away from the active site

    • Create compounds that prevent the open conformation required for substrate binding

  • Substrate-Based Approaches:

    • Design peptidomimetics based on natural lipoprotein signal sequences

    • Incorporate non-cleavable bonds at the cleavage site

    • Include lipid moieties that enhance membrane targeting

    • Optimize for selectivity against S. proteamaculans LspA over homologs

How can advanced biophysical techniques further elucidate the mechanism of LspA?

Cutting-edge approaches for mechanistic studies:

  • Time-Resolved Methods:

    • Time-resolved EPR to capture transient conformational states

    • Stopped-flow fluorescence to monitor real-time substrate binding and product release

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Temperature-jump experiments to study the kinetics of conformational transitions

  • Single-Molecule Techniques:

    • Single-molecule FRET to directly observe conformational dynamics

    • Atomic force microscopy to probe structural stability and unfolding pathways

    • Optical tweezers to measure force-induced conformational changes

    • Correlate single-molecule data with ensemble measurements from EPR and MD

  • Advanced Computational Methods:

    • Markov state models to map conformational landscape

    • Enhanced sampling MD techniques to access longer timescales

    • QM/MM simulations to study catalytic mechanism

    • Machine learning approaches to identify cryptic binding sites

How can the study of LspA conformational dynamics inform understanding of other membrane enzymes?

Broader implications for membrane enzyme research:

  • Methodological Advances:

    • The hybrid MD/EPR approach used for LspA provides a template for studying other membrane enzymes

    • Demonstrates how to capture conformational states not observed in crystal structures

    • Shows the importance of probing ns-timescale dynamics in membrane proteins

    • Illustrates how to correlate computational and experimental data effectively

  • Conceptual Frameworks:

    • The "clamp" mechanism involving the periplasmic helix may be a common feature in membrane-embedded enzymes

    • The role of conformational dynamics in protecting charged active sites from the membrane environment

    • How membrane proteins achieve substrate specificity while maintaining flexibility

    • The importance of analyzing protein dynamics at biologically relevant timescales

  • Therapeutic Applications:

    • Principles of targeting specific conformational states can be applied to other membrane enzyme targets

    • Understanding of how inhibitors like globomycin stabilize non-functional conformations

    • Approaches for disrupting critical conformational changes rather than just blocking active sites

    • Methods for designing inhibitors that exploit unique features of bacterial membrane enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.