Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Overview and Biological Context

Recombinant Serratia proteamaculans Na⁺-translocating NADH-quinone reductase subunit E (UniProt ID: A8GAC3) is a membrane-bound component of the Na⁺-NQR enzyme complex, a respiratory sodium pump critical for energy transduction in bacteria. This subunit is essential for electron transfer from NADH to quinone, coupled with sodium ion translocation across the membrane . The recombinant form is engineered for research applications, enabling studies on bacterial bioenergetics and antimicrobial drug development .

Subunit Composition and Cofactors

The Na⁺-NQR complex comprises six subunits (NqrA–F). Subunit E (NqrE) spans the membrane and interacts with Fe-S clusters and flavins in neighboring subunits . Key structural features include:

  • Primary Structure: 198 amino acids (1–198aa), with a predicted molecular weight of ~22 kDa .

  • Membrane Topology: Contains multiple transmembrane helices critical for sodium channel formation .

Key Domains

  • Fe-S Cluster-Binding Region: Coordinates with NqrD to stabilize redox-active cofactors .

  • Sodium-Binding Pocket: Proposed to reside near transmembrane helices, facilitating ion translocation .

Catalytic Mechanism

Na⁺-NQR transfers electrons from NADH to ubiquinone via a series of redox centers, including FAD, FMN, and Fe-S clusters. Subunit E facilitates conformational changes that drive sodium extrusion .

Functional AttributeDescription
Electron Transfer PathwayNADH → FAD (NqrF) → [2Fe-2S] (NqrF) → FMN (NqrB/C) → Ubiquinone
Sodium Translocation EfficiencyGenerates a sodium motive force (SMF) critical for ATP synthesis and flagellar rotation .
Superoxide ProductionMinor side reaction observed in vitro, linked to FMN redox cycling .

Expression and Purification

  • Host System: Expressed in E. coli with an N-terminal His tag for affinity chromatography .

  • Storage: Lyophilized powder in Tris buffer with 50% glycerol; stable at -20°C to -80°C .

Metabolic and Pathogenic Implications

  • Iron Homeostasis: Na⁺-NQR activity influences iron-sulfur cluster biogenesis, linking respiratory efficiency to metal metabolism .

  • Virulence in Vibrio cholerae: Na⁺-NQR deletion alters TCA cycle flux and reduces survival in vivo, highlighting its role in pathogenicity .

Comparative Analysis with Homologs

SpeciesSubunit E FeaturesFunctional Divergence
Vibrio cholerae202 residues; FMN-dependent redox switching Primary sodium pump in pathogens .
Pseudoalteromonas atlantica202 residues (UniProt Q15YQ2); 94% sequence similarity Marine adaptation; broader quinone specificity .

Future Directions

  • Drug Targeting: Na⁺-NQR’s absence in humans makes subunit E a candidate for narrow-spectrum antibiotics .

  • Mechanistic Studies: High-resolution cryo-EM structures are needed to resolve sodium translocation pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
nqrE; Spro_0957; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTLVLGISVPVNNLVY NLILRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPSLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGSGTGWMLAIVAMAGIREKLKYANVPAGLRGLGITF ITTGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions. This process is coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase (Na+-NQR) and what is its role in bacterial metabolism?

Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) is a unique sodium-pumping respiratory complex found exclusively in prokaryotes. It plays a crucial role in the metabolism of marine and pathogenic bacteria, including potentially Serratia proteamaculans. Na+-NQR serves as the primary entry point for reducing equivalents into the bacterial respiratory chain, catalyzing the oxidation of NADH and reduction of quinone. The free energy generated from this redox reaction drives the selective translocation of Na+ ions across the cell membrane, which energizes key cellular processes .

Unlike other respiratory complexes such as the H+-translocating NADH:quinone oxidoreductase (Complex I), Na+-NQR is unique to prokaryotes, making it an interesting target for both basic research and potential antimicrobial development. The complex typically consists of six subunits (NqrA-F), each with distinct roles in electron transfer and ion translocation .

Why is studying Na+-NQR from Serratia proteamaculans specifically important in research?

Studying Na+-NQR in Serratia proteamaculans offers several unique research opportunities:

  • Comparative bioenergetics - Understanding variations in Na+-NQR structure and function across different bacterial species provides insights into the evolution and adaptation of energy-transducing mechanisms.

  • Potential antimicrobial targets - Since Na+-NQR is absent in humans and other eukaryotes, it represents a potential target for species-specific antimicrobial agents against Serratia species, which can be opportunistic pathogens.

  • Ecological adaptation - As Serratia proteamaculans is found in diverse environments including soil, water, and plant surfaces, its Na+-NQR may exhibit unique adaptations compared to those from marine or obligate pathogens.

  • Structural diversity - Comparing the Na+-NQR subunit E from Serratia proteamaculans with homologs from other bacteria may reveal important structural variations that influence function and regulation.

What expression systems are most effective for recombinant production of Serratia proteamaculans Na+-NQR subunit E?

The choice of expression system for Na+-NQR subunit E requires careful consideration due to its nature as a membrane protein with potential cofactors. Based on current practices in recombinant protein technology, the following systems are recommended:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coli C41/C43(DE3)Specialized for membrane proteins; high yieldMay lack proper cofactor insertionInitial screening, structural studies
E. coli with pBAD promoterTight regulation, tunable expressionLower yields than T7 systemsToxic proteins, optimization studies
Homologous Serratia systemNative cofactor insertion, proper foldingLower yields, less established protocolsFunctional studies requiring authentic activity
Cell-free expressionDirect incorporation into nanodiscs/liposomesHigher cost, specialized equipment neededRapid screening, difficult-to-express constructs

For initial expression trials, E. coli systems with vector designs incorporating affinity tags (such as His-tag) are recommended, similar to other recombinant protein production strategies .

What are the critical factors to optimize when designing a purification workflow for recombinant Na+-NQR subunit E?

Purification of membrane proteins like Na+-NQR subunit E presents specific challenges that should be addressed through systematic optimization:

  • Membrane preparation: Careful cell lysis followed by differential centrifugation to isolate membrane fractions containing the target protein.

  • Detergent selection: Critical for extracting the protein from membranes while maintaining native structure. A screen of detergents (n-dodecyl-β-D-maltoside, digitonin, LMNG) should be performed to identify optimal solubilization conditions.

  • Buffer composition: Typically, pH 7.0-8.0 buffers containing 100-300 mM NaCl, 10-20% glycerol, and appropriate detergent at concentrations slightly above CMC are recommended.

  • Chromatography sequence: A typical workflow includes:

    • IMAC (immobilized metal affinity chromatography) using the His-tag

    • Ion exchange chromatography for higher purity

    • Size exclusion chromatography as a final polishing step

  • Quality control: Throughout purification, protein quality should be monitored using multiple methods including SDS-PAGE, Western blotting, and activity assays to ensure structural integrity .

Design of Experiments (DoE) approaches are particularly valuable for optimizing multiple purification parameters simultaneously, as they can identify interaction effects between different factors that might not be apparent with traditional one-factor-at-a-time optimization .

How can mass spectrometry be leveraged to characterize recombinant Serratia proteamaculans Na+-NQR subunit E?

Mass spectrometry (MS) offers powerful tools for comprehensive characterization of recombinant Na+-NQR subunit E:

  • Intact protein MS: Provides precise molecular weight determination, confirming proper expression and processing. For Na+-NQR subunit E, this can verify the presence of post-translational modifications or cofactor incorporation.

  • Peptide mapping: After proteolytic digestion (typically with trypsin), MS analysis of the resulting peptides can confirm sequence coverage, identify modifications, and detect unexpected sequence variations.

  • Native MS: Analysis of the intact Na+-NQR complex can reveal subunit stoichiometry and stability of protein-protein interactions within the complex.

  • Hydrogen-deuterium exchange (HDX) MS: This technique can probe protein structure and dynamics, identifying regions involved in cofactor binding or protein-protein interactions that are critical for Na+-NQR function.

  • Crosslinking MS: By introducing chemical crosslinks between proximal amino acid residues, this approach generates distance constraints that can inform structural models of the Na+-NQR complex .

MS provides detailed information that complements functional assays and structural studies, offering insights into both the primary structure and higher-order organization of the Na+-NQR complex.

What methods are recommended for assessing the enzymatic activity and functional integrity of purified Na+-NQR subunit E?

A comprehensive assessment of Na+-NQR activity should examine both electron transport and sodium translocation functions:

  • NADH oxidation assays:

    • Spectrophotometric monitoring of NADH absorption decrease at 340 nm

    • Determination of kinetic parameters (Km, Vmax) under varying conditions

    • Comparison between wild-type and mutant variants

  • Quinone reduction assays:

    • Direct measurement of quinone reduction using various quinone analogs

    • Assessment of substrate specificity and structure-activity relationships

  • Sodium translocation measurements:

    • Reconstitution into liposomes for sodium transport assays

    • Use of sodium-sensitive fluorescent dyes to monitor Na+ movement

    • Patch-clamp electrophysiology in reconstituted systems

  • Inhibitor studies:

    • Testing known Na+-NQR inhibitors (e.g., HQNO, korormicin)

    • Determination of IC50 values and inhibition mechanisms

  • Thermostability assays:

    • Differential scanning fluorimetry to assess protein stability

    • Effects of ligands, substrates, or inhibitors on protein thermal stability

For rigorous functional characterization, multiple complementary assays should be employed to distinguish specific Na+-NQR activity from non-specific NADH oxidation or quinone reduction .

How can site-directed mutagenesis be applied to study structure-function relationships in Serratia proteamaculans Na+-NQR subunit E?

Site-directed mutagenesis offers a powerful approach to probe the molecular mechanisms of Na+-NQR function:

  • Target selection strategies:

    • Conserved residues identified through multiple sequence alignment across bacterial species

    • Predicted functional sites (e.g., Na+ binding residues, quinone interaction sites)

    • Amino acids at subunit interfaces that may contribute to complex assembly

    • Transmembrane residues that potentially form the Na+ channel

  • Mutation design principles:

    • Conservative substitutions to probe specific chemical properties

    • Charge reversals to test electrostatic interactions

    • Alanine scanning to identify essential side chains

    • Introduction of reporter groups (e.g., cysteine for labeling studies)

  • Functional analysis of mutants:

    • Systematic comparison of wild-type and mutant proteins

    • Correlation of activity changes with structural predictions

    • Rescue experiments to confirm specific mechanisms

  • Structural interpretation:

    • Integration of mutational data with available structural information

    • Development of refined mechanistic models

    • Identification of residues critical for coupling electron transfer to Na+ transport

This approach can provide detailed insights into how specific amino acids contribute to Na+-NQR function and the molecular mechanism of sodium pumping.

What are the potential inhibitors of Serratia proteamaculans Na+-NQR and how might they be developed as antimicrobial agents?

The development of Na+-NQR inhibitors represents an opportunity for novel antimicrobials:

  • Known Na+-NQR inhibitors that may be effective against Serratia proteamaculans:

    • HQNO (2-n-heptyl-4-hydroxyquinoline-N-oxide)

    • Korormicin (a marine natural product with high specificity for Na+-NQR)

    • Certain phenothiazines and their derivatives

    • Silver ions and other heavy metals that may interact with protein cofactors

  • Rational inhibitor design strategies:

    • Structure-based approaches if structural information becomes available

    • Fragment-based drug discovery to identify binding hotspots

    • High-throughput screening of compound libraries against purified protein

    • Natural product screening from environmental sources

  • Antimicrobial development considerations:

    • Selectivity for bacterial Na+-NQR over human enzymes

    • Pharmacokinetic properties and toxicity profiles

    • Potential for resistance development

    • Spectrum of activity across different bacterial species

The absence of Na+-NQR in humans and other mammals makes inhibitors targeting this complex promising candidates for selective antimicrobial activity with potentially reduced side effects .

What are common challenges in expressing recombinant Serratia proteamaculans Na+-NQR subunit E, and how can they be addressed?

Researchers commonly encounter several challenges when working with Na+-NQR subunit E:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test multiple promoter systems and expression strains

    • Implement Design of Experiments (DoE) approach to systematically optimize expression conditions

    • Consider alternative expression systems if E. coli yields are insufficient

  • Inclusion body formation:

    • Lower induction temperature (16-25°C)

    • Reduce inducer concentration

    • Co-express with molecular chaperones (GroEL/GroES, trigger factor)

    • Utilize solubility-enhancing fusion partners (MBP, SUMO)

  • Improper cofactor incorporation:

    • Supplement growth media with cofactor precursors

    • Co-express with cofactor assembly machinery

    • Consider in vitro reconstitution of cofactors post-purification

  • Protein instability:

    • Optimize buffer conditions through systematic screening

    • Add stabilizing ligands or inhibitors

    • Carefully select detergents for membrane protein stabilization

    • Incorporate lipids that mimic the native membrane environment

ChallengeCommon SymptomsPotential SolutionsImplementation Strategy
Low expressionWeak band on SDS-PAGECodon optimization, lower temperatureTest multiple constructs in parallel
Inclusion bodiesProtein in insoluble fractionSlower expression, chaperone co-expressionSystematic screening of conditions
Cofactor issuesLow specific activityMedia supplementation, in vitro reconstitutionSpectroscopic monitoring of cofactor incorporation
Protein instabilityActivity loss during purificationOptimize buffers, add stabilizersDoE approach to buffer optimization

How can researchers distinguish between authentic Na+-NQR activity and background enzymatic reactions?

Distinguishing specific Na+-NQR activity from background reactions is critical for accurate characterization:

  • Inhibitor profiling:

    • Test with specific Na+-NQR inhibitors (e.g., HQNO, korormicin)

    • Compare with general respiratory inhibitors

    • Establish inhibition profiles that are characteristic of authentic Na+-NQR

  • Sodium dependence assays:

    • Measure activity in the presence and absence of sodium ions

    • Perform sodium concentration titrations

    • Use sodium ionophores to dissipate sodium gradients and observe effects on activity

  • Comprehensive control experiments:

    • Compare with heat-inactivated enzyme preparations

    • Use purified components from expression system without recombinant protein

    • Generate inactive mutants (e.g., by site-directed mutagenesis of catalytic residues)

  • Coupled assays with multiple readouts:

    • Simultaneously measure NADH oxidation and quinone reduction

    • Directly assess sodium translocation

    • Reconstitute into proteoliposomes to measure vectorial activity

  • Substrate specificity analysis:

    • Test multiple quinone substrates with different structures

    • Assess NADH versus NADPH specificity

    • Determine kinetic parameters for different substrates

Combining these approaches provides confidence that the measured activity truly represents Na+-NQR function rather than non-specific reactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.