Recombinant Serratia proteamaculans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

nuoK is a component of the NDH-1 complex in Serratia proteamaculans, a gram-negative bacterium. The NDH-1 complex (NADH:ubiquinone oxidoreductase) facilitates electron transfer from NADH to ubiquinone while translocating protons across the membrane, contributing to ATP synthesis . In bacteria, NDH-1 consists of 14 subunits, with nuoK being part of the membrane-bound fragment responsible for proton pumping and quinone reduction .

Key Features:

  • Gene Name: nuoK (UniProt ID: A8GH07)

  • Protein Length: Full-length (1–100 amino acids)

  • Expression System: E. coli with an N-terminal His-tag for purification .

Functional Role

nuoK is part of the NDH-1 membrane fragment, which includes subunits nuoA, nuoH, nuoJ, nuoK, nuoL, nuoM, and nuoN . These subunits form a proton channel and binding sites for ubiquinone. In Serratia proteamaculans, nuoK may:

  • Stabilize Quinone Binding: Interact with ubiquinone during electron transfer.

  • Facilitate Proton Pumping: Contribute to proton translocation across the membrane .

Recombinant Expression and Purification

nuoK is produced via heterologous expression in E. coli:

  • Expression System: E. coli BL21(DE3) or similar strains.

  • Purification: Nickel affinity chromatography due to the His-tag .

ParameterSpecification
Purity>90% (SDS-PAGE analysis)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
StabilityLyophilized powder; avoid repeated freeze-thaw cycles

Quality Control

  • SDS-PAGE: Confirms monomeric protein at ~11.4 kDa .

  • Mass Spectrometry: Verifies sequence accuracy (data not shown in sources).

Biochemical Studies

  • Electron Transfer Assays: Used to study quinone reduction and proton translocation in NDH-1 complexes .

  • Structural Elucidation: Co-crystallized with inhibitors or substrates to map interaction sites .

Diagnostic and Biotechnological Uses

  • ELISA: Serves as an antigen in immunoassays to detect anti-nuoK antibodies .

  • Protein-Protein Interaction Studies: Investigates interactions with other NDH-1 subunits (e.g., nuoA, nuoJ) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; Spro_3299; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLLVRRNLLFMLISLEVMINAAALAFIVAGSYWGQPDGQV MYILAISLAAAEASIGLALLLQLYRRRHTLNIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 acts as an electron shuttle, transferring electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is believed to be the enzyme's immediate electron acceptor. This process is coupled to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K in Serratia proteamaculans?

NADH-quinone oxidoreductase subunit K (nuoK) in Serratia proteamaculans functions as a component of the bacterial respiratory complex I, which catalyzes the transfer of electrons from NADH to quinones in the electron transport chain. To characterize this protein, researchers typically employ a combination of bioinformatic analysis and experimental methods. Begin with sequence alignment of the nuoK gene against homologs in other bacterial species using BLAST or Clustal Omega tools. For functional characterization, membrane fractionation followed by activity assays measuring NADH oxidation rates provides quantitative assessment of enzyme function. Recent studies suggest that bacterial NADH-quinone oxidoreductase complexes contain approximately 14 subunits with nuoK being one of the membrane-embedded components, likely containing three transmembrane helices based on hydropathy analyses and structural prediction models .

How does Serratia proteamaculans nuoK compare to other bacterial respiratory proteins?

When comparing S. proteamaculans nuoK to similar proteins in other species, researchers should implement a multi-faceted approach combining sequence conservation analysis, structural modeling, and functional assays. Phylogenetic analysis reveals that nuoK is highly conserved among Enterobacteriaceae but shows distinct variations in transmembrane domain organization compared to non-enteric bacteria. To methodically investigate these differences, first perform multiple sequence alignments using MUSCLE or T-Coffee algorithms, focusing on conserved residues within predicted transmembrane regions. Follow with homology modeling using structures of related bacterial respiratory complex I components as templates (e.g., from E. coli or Thermus thermophilus). Functional comparison requires purification of recombinant proteins from multiple species under identical conditions, followed by comparative enzymatic assays measuring electron transfer efficiency. The results typically demonstrate conservation of key catalytic residues while revealing species-specific variations in regulatory domains .

What techniques are effective for detecting nuoK expression in bacterial samples?

Detection of nuoK expression requires a combination of transcriptomic and proteomic approaches due to its membrane-embedded nature and relatively low abundance. For transcriptional analysis, design gene-specific primers targeting the nuoK open reading frame for RT-qPCR, normalizing expression against stable reference genes such as 16S rRNA or rpoD. At the protein level, develop custom antibodies against unique epitopes of S. proteamaculans nuoK, focusing on hydrophilic regions predicted to be exposed to the periplasm or cytoplasm. Western blotting of membrane fractions using these antibodies should be performed after optimizing membrane protein extraction protocols with detergents such as n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). For higher sensitivity, consider targeted mass spectrometry approaches using selected reaction monitoring (SRM) to quantify nuoK peptides. Expression patterns can be correlated with bacterial growth phases, with many respiratory complex components showing increased expression during late exponential phase when oxygen availability decreases .

What are the optimal conditions for expressing recombinant Serratia proteamaculans nuoK?

Heterologous expression of membrane proteins like nuoK presents significant challenges requiring careful optimization. For recombinant expression of S. proteamaculans nuoK, employ a dual approach targeting both prokaryotic and eukaryotic expression systems. In E. coli, use the C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression, combined with vectors containing mild promoters like pBAD to prevent protein aggregation. Optimize induction parameters using the following protocol: grow cultures at 37°C until OD600 of 0.6, then reduce temperature to 18°C before induction with 0.1mM IPTG (for T7-based systems) or 0.02% arabinose (for pBAD systems). For proper membrane insertion, co-express with chaperones such as DnaK/DnaJ. Alternatively, use Pichia pastoris expression system with methanol-inducible promoters for higher yields of properly folded protein. Assess expression through Western blotting of membrane fractions and verify functionality through NADH oxidation assays using artificial electron acceptors like ferricyanide .

Expression SystemTemperatureInducer ConcentrationExpression TimeYield (mg/L culture)
E. coli BL21(DE3)37°C1.0 mM IPTG4 hours0.1-0.3
E. coli C41(DE3)18°C0.1 mM IPTG16-20 hours0.5-0.8
E. coli C43(DE3)18°C0.1 mM IPTG18-24 hours0.7-1.0
P. pastoris25°C0.5% methanol72 hours1.2-2.0

What purification strategies yield the highest purity of functional nuoK protein?

Purification of membrane proteins like nuoK requires specialized techniques to maintain structural integrity and function. Begin with optimized cell lysis using either French press or sonication in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and protease inhibitors. For membrane fraction isolation, perform differential centrifugation (10,000×g for 20 min to remove debris, followed by 100,000×g for 1 hour to pellet membranes). Solubilize membranes using a detergent screen testing DDM, LMNG, and digitonin at concentrations ranging from 0.5-2%, with LMNG typically providing the best balance between extraction efficiency and protein stability for respiratory complex components. For affinity purification, incorporate a His10-tag at the C-terminus of nuoK (rather than N-terminus, which may interfere with membrane insertion) and purify using Ni-NTA resin with imidazole gradient elution (20-300 mM). Further purify using size exclusion chromatography on Superose 6 column equilibrated with buffer containing 0.05% LMNG. Assess purity by SDS-PAGE and protein identity by mass spectrometry, while verifying functional integrity through activity assays measuring NADH:ubiquinone oxidoreductase activity .

How can researchers effectively measure the enzymatic activity of purified nuoK?

Measuring the enzymatic activity of purified nuoK requires specialized assays due to its role within the larger NADH-quinone oxidoreductase complex. As an individual subunit, nuoK does not possess independent catalytic activity, necessitating reconstitution approaches or indirect measurement methods. First, determine if the purified protein maintains its native conformation using circular dichroism spectroscopy, with particular attention to alpha-helical content characteristic of membrane proteins. For functional studies, incorporate purified nuoK into proteoliposomes or nanodiscs using a lipid composition mimicking bacterial membranes (phosphatidylethanolamine:phosphatidylglycerol:cardiolipin at 7:2:1 ratio). To assess the contribution of nuoK to electron transport, reconstitute with other purified complex I subunits and measure NADH oxidation rates spectrophotometrically at 340 nm. Alternative approaches include measuring proton translocation using pH-sensitive fluorescent probes like ACMA (9-amino-6-chloro-2-methoxyacridine). For structure-function studies, perform site-directed mutagenesis of conserved residues followed by activity assays to identify critical amino acids involved in protein-protein interactions within the complex .

How does nuoK function relate to Serratia proteamaculans pathogenicity?

The relationship between nuoK function and S. proteamaculans pathogenicity represents a complex research area requiring multidisciplinary approaches. To investigate this connection, first generate nuoK knockout mutants using CRISPR-Cas9 or homologous recombination techniques, confirming deletion by PCR and sequencing. Compare growth curves of wild-type and ΔnuoK strains under various conditions, including nutrient limitation and oxidative stress, as respiratory chain deficiencies often manifest most prominently under stress conditions. For pathogenicity assessment, perform invasion assays using appropriate cell culture models and measure adhesion efficiency and intracellular survival rates. Research indicates that bacterial invasion activity appears at stationary growth phase, corresponding to maximal bacterial population density in vitro, suggesting potential regulation by quorum sensing systems . Examine whether nuoK deletion affects expression of virulence factors using RNA-seq and qRT-PCR validation. Additionally, investigate whether energy metabolism alterations in the ΔnuoK strain affect the production of quorum sensing signaling molecules like acyl-homoserine lactones (AHLs), which regulate virulence gene expression. Studies with S. proteamaculans have shown that inactivation of the AHL synthase sprI gene results in increased invasive activity, correlating with altered expression of membrane proteins .

What genetic regulatory mechanisms control nuoK expression under different environmental conditions?

Investigation of nuoK's genetic regulation requires a systems biology approach integrating transcriptomics, proteomics, and functional genomics. To elucidate regulatory mechanisms, first identify putative promoter regions and transcription factor binding sites through in silico analysis using tools like MEME, JASPAR, and RegulonDB. Construct transcriptional reporter fusions (nuoK promoter:GFP or luciferase) to monitor expression in real-time under varying environmental conditions including oxygen concentration, carbon source availability, and growth phase transitions. Perform chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors that directly interact with the nuoK promoter region. RNA-seq analysis under different growth conditions can reveal co-expressed genes, potentially identifying operons and regulatory networks. To assess post-transcriptional regulation, implement ribosome profiling to measure translation efficiency. Quorum sensing systems, such as the LuxI/LuxR-type system in S. proteamaculans consisting of regulatory protein SprR and AHL synthase SprI, may influence electron transport chain component expression during high cell density conditions . Construct double mutants (ΔsprI/ΔnuoK) to investigate potential regulatory interactions between quorum sensing and respiratory metabolism.

How might structural modifications of nuoK affect electron transport chain efficiency?

Investigating structure-function relationships in nuoK requires integrating computational modeling with experimental mutagenesis and biophysical techniques. Begin with advanced homology modeling using AlphaFold2 or RoseTTAFold to predict the tertiary structure of S. proteamaculans nuoK based on known structures of homologous proteins. Identify conserved residues across bacterial species that might be critical for function using ConSurf or Rate4Site algorithms. Design a systematic mutagenesis strategy targeting: (1) conserved charged residues potentially involved in proton translocation, (2) residues at predicted protein-protein interfaces with other complex I subunits, and (3) residues lining putative quinone-binding sites. Express and purify each mutant protein, then perform functional assays measuring electron transfer rates and proton pumping efficiency. For detailed mechanistic insights, reconstitute mutant proteins into nanodiscs and perform hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes during catalysis. Complementary techniques like electron paramagnetic resonance (EPR) spectroscopy can identify changes in the electronic environment of iron-sulfur clusters in reconstituted complexes containing mutant nuoK. Recent research with bacterial respiratory complexes suggests that even subtle mutations in membrane-embedded subunits can significantly alter proton translocation efficiency without necessarily affecting electron transfer rates .

How can researchers address inconsistent expression of recombinant nuoK protein?

Inconsistent expression of membrane proteins like nuoK represents a common challenge requiring systematic troubleshooting approaches. When encountering variable expression, first examine codon usage in the expression construct – membrane proteins often contain rare codons that can limit translation efficiency. Optimize the coding sequence using tools like GeneOptimizer or JCat, and consider co-expressing with additional tRNA genes using strains like Rosetta(DE3). For toxic membrane proteins, implement tightly controlled expression systems using tunable promoters like the tetracycline-inducible system rather than strong constitutive promoters. Monitor cell viability during expression using growth curves and viable cell counts, as membrane protein overexpression can compromise membrane integrity. If inclusion bodies form despite optimization, develop a refolding protocol using a mild detergent gradient dialysis method: solubilize inclusion bodies in 8M urea or 6M guanidinium hydrochloride, then gradually dialyze against decreasing concentrations of denaturant in the presence of phospholipids and appropriate detergents. Alternatively, explore fusion partners that enhance membrane protein expression, such as Mistic or GlpF. For particularly recalcitrant proteins, consider cell-free expression systems using bacterial or wheat germ extracts supplemented with liposomes to facilitate proper folding of membrane proteins during translation .

What approaches help in resolving contradictory results when studying NADH-quinone oxidoreductase activity?

Contradictory results in enzyme activity studies often stem from methodological variations and sample preparation differences. To systematically address this issue, first establish a standardized protocol for membrane preparation and enzyme assay conditions, documenting all variables including buffer composition, pH, temperature, detergent concentration, and substrate purity. Implement internal controls in each experiment, including positive controls (commercially available complex I from related species) and negative controls (samples treated with specific inhibitors like rotenone or piericidin A). When comparing results across studies, account for differences in protein concentration determination methods by using multiple techniques (Bradford, BCA, and amino acid analysis) to establish a reliable quantification benchmark. For activity measurements, spectrophotometric assays monitoring NADH oxidation should be complemented with alternative methods like oxygen consumption measurements using Clark-type electrodes or hydrogen peroxide production using Amplex Red assays. In reconstitution experiments, carefully control the lipid-to-protein ratio and membrane composition, as these significantly affect enzyme activity. Statistical analysis should employ appropriate methods for comparing enzymatic data, such as enzyme kinetics models (Michaelis-Menten, Hill equation) rather than simple comparison of endpoint measurements. Document all environmental variables during experiments, including oxygen tension and ambient redox conditions, which can dramatically influence respiratory chain enzyme measurements .

How can researchers distinguish between direct and indirect effects when studying nuoK function?

Distinguishing direct from indirect effects in nuoK functional studies requires complementary approaches and careful experimental design. Implement genetic complementation assays where the ΔnuoK phenotype is rescued by expressing wild-type nuoK from a plasmid under native or inducible promoters. If the phenotype is fully restored, it suggests direct causation; partial restoration may indicate secondary effects. For biochemical verification, perform direct binding assays using techniques like microscale thermophoresis (MST) or surface plasmon resonance (SPR) to establish physical interactions between nuoK and proposed interaction partners. Time-course experiments are crucial – immediate effects (seconds to minutes) after perturbation likely represent direct consequences, while delayed responses (hours) may indicate secondary adaptations through gene expression changes. When studying invasive activity changes in bacterial mutants, determine whether alterations in outer membrane protein composition (such as OmpX) represent direct effects or adaptive responses to metabolic changes . For complex phenotypes, implement metabolic flux analysis using 13C-labeled substrates to trace how electron transport chain alterations affect broader metabolic networks. Systems biology approaches combining transcriptomics, proteomics, and metabolomics data sets can help distinguish primary from secondary effects through temporal analysis and network modeling of causal relationships. Consider genetic epistasis experiments, where double mutants (ΔnuoK plus mutation in a suspected downstream effector) are analyzed to establish pathway relationships .

What emerging technologies show promise for nuoK structural and functional studies?

Emerging technologies are rapidly expanding possibilities for studying membrane proteins like nuoK with unprecedented resolution and functional insight. Cryo-electron microscopy (cryo-EM) represents a revolutionary approach for membrane protein structural determination without crystallization requirements. For nuoK research, integrating single-particle cryo-EM with subtomogram averaging could reveal how this subunit functions within the larger respiratory complex under near-native conditions. Complementary to structural studies, advanced spectroscopic techniques like single-molecule FRET can capture dynamic conformational changes during enzyme catalysis when strategically placed fluorophores are incorporated through unnatural amino acid technology. For functional studies, development of genetically encoded biosensors for membrane potential and NADH/NAD+ ratios enables real-time monitoring of respiratory complex activity in living cells. Looking forward, integrating artificial intelligence approaches with molecular dynamics simulations will allow prediction of how specific mutations might affect proton translocation pathways through nuoK. Microfluidic organ-on-chip technology presents opportunities to study how nuoK mutations affect bacterial behavior in more physiologically relevant microenvironments. For genetic manipulation, CRISPR interference (CRISPRi) systems with tunable repression allow titration of nuoK expression levels rather than complete knockout, potentially revealing dosage-dependent phenotypes that complete gene deletion might mask .

How might understanding nuoK function contribute to novel antimicrobial development?

The essential role of respiratory complexes in bacterial energy metabolism makes them attractive targets for antimicrobial development, with nuoK research potentially contributing to novel therapeutic strategies. To explore this avenue, first perform comprehensive comparative genomics across pathogenic and non-pathogenic bacterial species to identify unique structural features of nuoK in pathogens that could be selectively targeted. Implement computational drug screening using molecular docking against predicted binding pockets in the nuoK structure, focusing on regions essential for proton translocation or subunit interaction rather than highly conserved catalytic domains shared with human respiratory complexes. For experimental validation, develop a high-throughput screening system using bacterial strains with reporter genes linked to respiratory function. Test promising compounds for inhibition of purified bacterial complex I while confirming lack of activity against mammalian complex I. Beyond direct inhibition, explore adjuvant approaches where respiratory chain modulation could potentiate existing antibiotics by altering membrane potential or proton motive force. Investigate whether nuoK inhibition affects biofilm formation, as respiratory deficiencies often alter bacterial community behaviors. Structure-based drug design informed by cryo-EM structures could lead to development of peptidomimetics that disrupt assembly of respiratory complexes. The regulation connection between quorum sensing and respiratory function in S. proteamaculans suggests potential for dual-targeting strategies that simultaneously disrupt bacterial communication and energy generation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.