Recombinant Serratia proteamaculans p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; Spro_4391; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
aaeA
Target Protein Sequence
MKNFSIKITRIAITLILVLLGIIAIFKAWVFYTESPWTRDAKFTADVVAIAPDVTGLLTD VPLVDNQLVKKGQVLLVIDQPRYQQALAEANADVAYYQTLAAEKRREAGRRVRLGVQAMS QEEIDQANNVLQTVEHQLAKAVATRELAKLDLERTTVRAPADGWITNLNVHAGEYITRGS VAVALVKKNSFYILAYLEETKLNGLNKGDRAEITPLGSNRIMHGTVDSVAAAVNNSSSTV NSKGLASIDSNLEWVRLAQRVPVKILLDDKDQLHPYPAGTTATVVITGKNDRATDSGSPF VRLMHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit in Serratia proteamaculans?

AaeA is a membrane fusion protein (MFP) component of the AaeAB efflux system in Serratia proteamaculans. It functions as part of a two-component efflux pump that exports aromatic carboxylic acids from the bacterial cell. Based on homology with the E. coli system, AaeA corresponds to the YhcQ protein (later renamed AaeA), which forms an essential part of the efflux mechanism . The AaeA protein creates a channel connecting the inner membrane transporter (AaeB) with the outer membrane, facilitating substrate export across the cell envelope in this gram-negative bacterium.

How does the AaeA subunit interact with AaeB to form a functional efflux system?

The AaeA subunit works cooperatively with AaeB to form a bipartite efflux system. AaeA functions as the membrane fusion protein that bridges the inner and outer membranes, while AaeB serves as the inner membrane transporter responsible for substrate recognition and energy-dependent transport. Studies in E. coli demonstrate that both components are necessary and sufficient for efflux activity, with expression of both yhcQ (aaeA) and yhcP (aaeB) required to suppress hypersensitivity to p-hydroxybenzoic acid . In S. proteamaculans, this functional relationship is likely conserved, with the two proteins working in concert to form a continuous channel for substrate extrusion.

What is the genetic organization of the aae operon in S. proteamaculans?

Based on comparative analysis with E. coli, the aae operon in S. proteamaculans likely consists of several genes in a similar arrangement. In E. coli, the operon includes aaeR (a LysR-type transcriptional regulator), aaeX (a small protein of unknown function), aaeA (membrane fusion protein), and aaeB (efflux transporter) . These genes were originally designated as yhcS, yhcR, yhcQ, and yhcP, respectively. The regulatory gene aaeR is typically transcribed divergently from the structural genes. While the exact organization in S. proteamaculans may have some differences, genomic analyses suggest conservation of this basic structure across related bacterial species.

What expression systems are most effective for recombinant production of S. proteamaculans AaeA?

The optimal expression system for S. proteamaculans AaeA depends on experimental requirements. For structural studies requiring high yields, E. coli BL21(DE3) with pET-based vectors provides robust expression when cultured at lower temperatures (16-20°C) to facilitate proper folding. For functional studies, membrane protein expression systems such as C41(DE3) or C43(DE3) E. coli strains are preferable as they accommodate the potentially toxic effects of membrane protein overexpression. When expressing AaeA, it's critical to consider that as a membrane-associated protein, it requires careful optimization of induction conditions, including IPTG concentration (typically 0.1-0.5 mM) and induction time (4-16 hours).

What purification challenges are specific to the AaeA membrane fusion protein?

Purification of AaeA presents several challenges typical of membrane-associated proteins:

  • Detergent selection: Screening multiple detergents is essential, with mild non-ionic detergents (DDM, LMNG, or C12E8) typically preserving protein structure and function.

  • Solubilization efficiency: Optimization of detergent:protein ratios is critical to achieve efficient extraction without denaturation.

  • Protein stability: AaeA may exhibit reduced stability in solution, necessitating the addition of glycerol (10-20%) and careful temperature control during purification.

  • Aggregation tendency: Size-exclusion chromatography is essential to separate monomeric from aggregated forms.

A typical purification protocol would involve membrane fraction isolation, detergent solubilization, immobilized metal affinity chromatography (when using His-tagged constructs), and size-exclusion chromatography as final polishing step.

What are the known substrates of the AaeAB efflux system in S. proteamaculans?

The AaeAB efflux system in S. proteamaculans, like its E. coli counterpart, likely has specificity for aromatic carboxylic acids. In E. coli, studies demonstrated that the AaeAB pump transports p-hydroxybenzoic acid (pHBA) and related compounds . Comparative analysis suggests that S. proteamaculans AaeAB may transport similar substrates, potentially including:

SubstrateChemical StructureRelative Transport Efficiency
p-hydroxybenzoic acidC₇H₆O₃High
Benzoic acidC₇H₆O₂Moderate
Salicylic acidC₇H₆O₃Moderate
Protocatechuic acidC₇H₆O₄Variable

The substrate specificity appears narrow, as only select aromatic carboxylic acids among hundreds of diverse compounds tested were identified as substrates for the E. coli AaeAB pump .

How can AaeA efflux activity be measured in laboratory settings?

Several complementary approaches can be employed to measure AaeA-mediated efflux activity:

  • Growth inhibition assays: Comparing growth of wild-type, aaeA-deficient, and complemented strains in the presence of increasing concentrations of substrate compounds. This is supported by E. coli studies showing hypersensitivity to pHBA in yhcP (aaeB) mutant strains .

  • Fluorescent substrate accumulation: Using fluorescent substrates or derivatives that allow quantification of intracellular accumulation in real-time.

  • Radioactive substrate transport: Measuring the export of radiolabeled substrates from preloaded cells or membrane vesicles.

  • pH-dependent transport assays: Utilizing the pH sensitivity of substrates to track transport across membranes in reconstituted proteoliposomes.

  • Electrophysiological measurements: For advanced studies, patch-clamp or planar lipid bilayer recordings can provide direct measurement of transport activity when reconstituted into artificial membranes.

How is expression of the aaeA gene regulated in S. proteamaculans?

Based on the E. coli model and understanding of S. proteamaculans genomics, aaeA expression is likely regulated through multiple mechanisms:

  • Transcriptional regulation: In E. coli, the LysR-type regulator AaeR (YhcS) controls expression of the aaeXAB operon . In S. proteamaculans, a homologous regulatory protein likely serves this function.

  • Substrate induction: Aromatic carboxylic acids, particularly p-hydroxybenzoic acid, act as inducers of aaeXAB expression in E. coli . Similar substrate-dependent induction likely occurs in S. proteamaculans.

  • Quorum sensing integration: S. proteamaculans possesses a LuxI/LuxR-type quorum sensing (QS) system with regulatory protein SprR and AHL synthase SprI . While direct evidence linking QS to aaeA regulation is lacking, homoserine lactone signaling molecules involved in quorum sensing were found in all analyzed S. proteamaculans strains and can trigger gene expression responses , potentially including efflux systems.

  • Environmental factors: Iron limitation and other stress conditions may modulate expression, as observed for other membrane proteins in S. proteamaculans .

What is the role of the AaeR regulator in controlling AaeA expression?

The AaeR regulator (homologous to YhcS in E. coli) likely functions as the primary transcriptional controller of the aae operon in S. proteamaculans. In E. coli, inactivation of yhcS (aaeR) results in hypersensitivity to p-hydroxybenzoic acid comparable to that seen in yhcP (aaeB) mutants . This suggests that AaeR acts as a positive regulator, essential for adequate expression of the efflux system components. The regulation mechanism likely involves:

  • Direct binding of aromatic carboxylic acids to AaeR, inducing a conformational change

  • Interaction of activated AaeR with promoter regions upstream of the aaeXAB operon

  • Facilitation of RNA polymerase recruitment and transcription initiation

Proper function of this regulatory system is critical for adaptive responses to environmental challenges, including exposure to potentially toxic aromatic compounds.

What structural features distinguish AaeA from other membrane fusion proteins?

AaeA belongs to the membrane fusion protein (MFP) family but possesses distinctive structural features compared to other MFPs. While specific structural data for S. proteamaculans AaeA is limited, comparative analysis with characterized MFPs suggests:

  • Domain organization: AaeA likely contains a membrane-proximal domain, a β-barrel domain, and a coiled-coil α-helical domain that extends into the periplasmic space.

  • Substrate channel: The arrangement of α-helical bundles creates a substrate-compatible channel with specific physicochemical properties suited for aromatic carboxylic acid transport.

  • Interface regions: Specialized interfaces for interaction with the inner membrane transporter (AaeB) and potentially with outer membrane components.

  • Oligomerization surfaces: Surfaces that facilitate the formation of functional oligomeric assemblies necessary for creating a continuous conduit across the periplasmic space.

Mutagenesis studies targeting these regions would help elucidate structure-function relationships specific to AaeA.

How do post-translational modifications affect AaeA function?

Post-translational modifications may significantly impact AaeA function, although specific modifications in S. proteamaculans AaeA have not been extensively characterized. Potential modifications and their functional implications include:

  • Disulfide bond formation: Proper formation of disulfide bonds in the periplasmic domains is critical for structural integrity and function of many MFPs.

  • Phosphorylation: Phosphorylation of specific residues could modulate AaeA activity in response to cellular signaling pathways.

  • Proteolytic processing: Limited proteolysis might be involved in maturation or regulation of AaeA function, as suggested by the inverse correlation between protealysin activity and bacterial invasion observed in S. proteamaculans .

Experimental approaches to investigate these modifications include mass spectrometry-based proteomic analysis, site-directed mutagenesis of potential modification sites, and functional assays comparing wild-type and modification-deficient variants.

How does the AaeAB efflux system contribute to S. proteamaculans adaptation in food environments?

The AaeAB efflux system likely plays an important role in S. proteamaculans adaptation to food environments, particularly seafood products where this species is prevalent . Several mechanisms may contribute to this adaptive advantage:

  • Detoxification: Export of potentially harmful aromatic compounds encountered in food matrices, particularly those derived from protein degradation common in seafood.

  • Metabolic relief: Functioning as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism , particularly important during nutrient fluctuations in food environments.

  • Competitive advantage: Contribution to the dominance of S. proteamaculans in food spoilage communities, potentially through:

    • Enhanced tolerance to antimicrobial compounds

    • Modulation of quorum sensing through export of signaling molecules

    • Interaction with other spoilage mechanisms

  • Survival during processing: Resistance to stress conditions during food processing, similar to the higher resistance of S. proteamaculans to ham production processes compared to other bacteria .

The prevalence of S. proteamaculans in multiple seafood products (fresh salmon, cold-smoked salmon, cooked shrimps, and fresh tuna) suggests robust adaptation mechanisms, potentially involving efflux systems like AaeAB .

What is the relationship between AaeA function and bacterial virulence or invasion?

While direct evidence linking AaeA to virulence is limited, several indirect connections suggest potential involvement:

  • Invasive activity regulation: S. proteamaculans demonstrates invasive activity at stationary growth phase, coinciding with maximal bacterial population density . Efflux pumps may contribute to this phenotype by modulating cellular physiology or exporting invasion-promoting factors.

  • Quorum sensing interaction: The S. proteamaculans quorum sensing system regulates invasive activity , and homoserine lactone signaling molecules found in S. proteamaculans strains can trigger various gene expression responses , potentially including efflux systems.

  • Outer membrane protein interactions: Increased expression of the outer membrane protein ompX gene correlates with increased invasive activity in S. proteamaculans . AaeA, as a membrane fusion protein, may interact with or influence outer membrane proteins important for invasion.

  • Stress response integration: AaeA-mediated efflux may be part of a broader stress response network that includes virulence factor expression, particularly under iron-limiting conditions, which correlate with bacterial invasion .

Further research using aaeA knockout mutants and complementation studies would help elucidate the specific contribution of this efflux system to S. proteamaculans virulence and invasion.

How does S. proteamaculans AaeA compare to homologs in other bacterial species?

Comparative analysis reveals both conservation and divergence between S. proteamaculans AaeA and its homologs in other bacterial species:

The genomic analysis of S. proteamaculans reveals that it harbors a larger accessory genome than closely related species like S. liquefaciens, suggesting greater adaptability to different niches and functions . This genomic plasticity may extend to the aaeA gene, potentially conferring unique functional properties to the S. proteamaculans AaeA protein.

What evolutionary pressures have shaped AaeA diversity across Serratia species?

The evolution of AaeA across Serratia species likely reflects adaptation to diverse ecological niches and selective pressures:

  • Habitat adaptation: Serratia species are found in various environments including soil, water, plants, insects, and food products . Different habitats present distinct chemical challenges, driving adaptation of efflux systems.

  • Substrate diversity: Variation in the types and concentrations of aromatic compounds encountered in different niches has likely shaped the substrate specificity of AaeA.

  • Horizontal gene transfer: The presence of mobile genetic elements (plasmids, transposases, phages) identified in S. proteamaculans suggests that horizontal gene transfer may have contributed to AaeA evolution and diversification.

  • Functional constraints: Despite environmental adaptations, the core functional architecture of AaeA is conserved, reflecting essential structural requirements for membrane fusion protein function.

The preponderance of S. proteamaculans in seafood environments compared to other Serratia species suggests specific adaptations, potentially including optimized efflux systems, that confer a competitive advantage in these niches .

What reconstitution systems are most effective for studying purified AaeA function?

Several reconstitution approaches can be employed to study purified AaeA function, each with specific advantages:

  • Proteoliposomes: Incorporation of purified AaeA together with AaeB into liposomes allows direct measurement of transport activity using fluorescent or radioactive substrates. Optimum lipid composition typically includes a mixture of E. coli polar lipids with phosphatidylcholine at a 7:3 ratio.

  • Nanodiscs: Reconstitution into membrane scaffold protein (MSP)-based nanodiscs provides a native-like membrane environment while maintaining a monodisperse, soluble sample suitable for structural and biophysical studies.

  • Polymer-based systems: Amphipols or styrene-maleic acid lipid particles (SMALPs) can stabilize AaeA-AaeB complexes in a detergent-free environment, preserving native interactions.

  • Co-reconstitution approaches: For complete functional studies, co-reconstitution with additional components such as the outer membrane factor (if identified) would provide insights into the complete transport pathway.

Functional verification in these systems typically involves substrate transport assays using pH-sensitive dyes, fluorescent substrate analogs, or radiolabeled compounds to monitor efflux activity.

How can molecular dynamics simulations enhance understanding of AaeA function?

Molecular dynamics (MD) simulations provide valuable insights into AaeA structure and function that may be difficult to obtain experimentally:

  • Conformational dynamics: MD simulations can reveal the conformational changes that occur during the transport cycle, including opening and closing of the periplasmic channel.

  • Substrate interactions: Docking and MD studies can identify key residues involved in substrate recognition and translocation pathway, guiding subsequent mutagenesis experiments.

  • Protein-protein interfaces: Simulations of the AaeA-AaeB interface can elucidate the molecular details of their functional coupling and how conformational changes are transmitted between components.

  • Membrane interactions: Coarse-grained and all-atom simulations can reveal how AaeA interacts with and potentially deforms the membrane during the transport process.

  • Water and ion dynamics: Simulations tracking water molecules and ions can identify potential substrate translocation pathways and energy coupling mechanisms.

For accurate simulations, homology modeling based on structurally characterized MFPs (such as AcrA, MexA, or MacA) can provide a starting structure, which can then be refined through simulation and validated against experimental data from cross-linking or spectroscopic studies.

How might AaeA function be exploited to develop novel approaches to food preservation?

Understanding AaeA function opens several potential avenues for food preservation strategies, particularly for seafood products where S. proteamaculans is a dominant spoilage organism :

  • Targeted inhibitors: Development of specific inhibitors of AaeA function could reduce S. proteamaculans persistence in food environments without broad antimicrobial effects that might select for resistance.

  • Environmental modifications: Altering storage conditions to minimize AaeA-mediated adaptation, such as modified atmosphere packaging with specific gas compositions that downregulate efflux pump expression.

  • Competitive exclusion: Engineering of probiotic or protective cultures with enhanced competitive capabilities against S. proteamaculans, potentially targeting vulnerabilities related to efflux capacity.

  • Biomarker development: Using AaeA expression or activity as a biomarker for early detection of S. proteamaculans contamination before sensory spoilage becomes apparent.

  • Natural antimicrobials: Screening for plant-derived compounds that specifically interfere with AaeA function while meeting food safety requirements.

These approaches could help address the significant issue of food spoilage by S. proteamaculans, which contributes to food losses and waste particularly in seafood products .

What are the most promising methodologies for high-throughput screening of AaeA inhibitors?

Several high-throughput screening approaches can be employed to identify potential inhibitors of AaeA function:

  • Fluorescent substrate accumulation assays: Measuring intracellular accumulation of fluorescent substrates or substrate analogs in whole cells expressing the AaeAB system in the presence of test compounds.

  • Growth inhibition synergy screens: Identifying compounds that enhance the antimicrobial activity of known AaeAB substrates through efflux inhibition.

  • Thermal shift assays: Detecting compounds that bind to and stabilize purified AaeA, potentially interfering with its function.

  • Surface plasmon resonance (SPR): Screening for direct binding of compounds to immobilized AaeA using label-free detection.

  • Biolayer interferometry (BLI): Alternative optical biosensor method for detecting direct binding interactions.

  • Computational approaches: Virtual screening using molecular docking and machine learning algorithms to identify potential inhibitors based on structural models of AaeA.

When developing screening assays, it's essential to include appropriate controls to distinguish between specific AaeA inhibitors and compounds with broader effects on membrane integrity or cellular physiology.

What are the most critical unresolved questions regarding AaeA structure and function?

Despite advances in understanding efflux pumps, several critical questions about S. proteamaculans AaeA remain unresolved:

  • The high-resolution structure of S. proteamaculans AaeA, particularly in complex with AaeB and potential outer membrane components

  • The precise substrate binding sites and translocation pathway through the AaeAB complex

  • The energetic coupling mechanism that drives substrate export

  • The complete regulatory network controlling aaeA expression in different environmental conditions

  • The potential role of AaeA in biofilm formation and persistence in food environments

  • The evolutionary relationship between AaeA and other membrane fusion proteins across bacterial species

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, microbiology, and computational methods.

How might systems biology approaches advance understanding of AaeA in the context of bacterial physiology?

Systems biology approaches offer powerful tools for understanding AaeA function in the broader context of bacterial physiology:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.