Recombinant Serratia proteamaculans Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arnE; Spro_2159; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
arnE
Target Protein Sequence
MIVGYLLVVLVSLLTCGGQLCQKQAALSWQLPPEVRRGVTLRWLALAVLLLGLGMAVWLN VLQRLPLSLAYPTLSLNFVLVTLAARWLFNEPTTARHWYGVASIMLGILLMSINP
Uniprot No.

Target Background

Function

This protein functions as a 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) flippase, translocating it across the inner membrane from the cytoplasm to the periplasm.

Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the taxonomic history of Serratia proteamaculans impact our understanding of arnE?

The taxonomic classification of Serratia proteamaculans has undergone substantial revision since its initial description in 1919 by Paine and Stansfield as Pseudomonas proteamaculans . The organism was subsequently reassigned to various genera including Xanthomonas, Erwinia, and Enterobacter before its final classification as Serratia proteamaculans based on biochemical properties, polynucleotide sequence relatedness, and pathobiological capacity . This taxonomic journey is relevant to arnE research because:

  • Strain authentication is critical when working with Serratia proteamaculans isolates

  • Historical literature may reference arnE under different species names

  • Comparative genomic analyses must account for taxonomic reclassification

  • Phylogenetic relationships with other Serratia species influence the interpretation of arnE functional conservation

Notably, Serratia proteamaculans is now considered a senior subjective synonym of S. liquefaciens, which has implications for comparative studies of arnE across Serratia species .

What experimental methods are most effective for confirming the identity and purity of recombinant arnE preparations?

When confirming the identity and purity of recombinant arnE preparations, researchers should implement a multi-method validation approach:

  • SDS-PAGE Analysis: Validate molecular weight (approximately 12.9 kDa) using reducing and non-reducing conditions to detect potential oligomerization

  • Mass Spectrometry:

    • Peptide mass fingerprinting following tryptic digestion

    • Intact protein mass analysis to confirm post-translational modifications

  • Western Blot Analysis: Using anti-His tag antibodies (if His-tagged) or specific anti-arnE antibodies

  • Functional Assays:

    • Liposome-based flippase activity assays

    • Reconstitution in proteoliposomes to measure substrate translocation

  • Circular Dichroism: To assess secondary structure content, particularly important for confirming proper folding of membrane proteins

  • ELISA-Based Quantification: Commercial kits are available specifically for recombinant Serratia proteamaculans arnE protein detection and quantification

The combination of these methods provides comprehensive validation beyond simple gel electrophoresis, which is particularly important for membrane proteins that may aggregate or misfold during recombinant expression.

What are the optimal expression systems and conditions for producing functional recombinant arnE protein?

The expression of functional recombinant arnE from Serratia proteamaculans presents several challenges due to its nature as a membrane protein. Optimal expression systems and conditions include:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesYield
E. coli C41(DE3)Designed for membrane proteins; reduces toxicityMay require codon optimization2-5 mg/L
E. coli Lemo21(DE3)Tunable expression levels; reduces inclusion bodiesMore complex induction protocol3-7 mg/L
Cell-free systemsAvoids toxicity; direct incorporation into liposomesHigher cost; lower yield0.5-1 mg/mL
Yeast (P. pastoris)Eukaryotic folding machinery; scalableLonger expression time; glycosylation issues5-10 mg/L

Optimal Conditions:

  • Temperature: Lower temperatures (16-20°C) after induction to reduce inclusion body formation

  • Induction Parameters: Low IPTG concentrations (0.1-0.5 mM) or auto-induction media

  • Media Supplements: Addition of specific phospholipids to stabilize the protein during expression

  • Vector Design: Inclusion of a removable fusion partner (MBP, SUMO) to enhance solubility

  • Detergent Screening: Systematic testing of detergents for extraction (DDM, LMNG, or amphipols)

For investigating membrane protein function like arnE, incorporation of the protein into nanodiscs or proteoliposomes post-purification enhances stability and enables functional studies of its flippase activity.

How can researchers optimize protein yield while maintaining the structural integrity of recombinant arnE?

Maintaining structural integrity while optimizing yield of recombinant arnE requires addressing the unique challenges of membrane protein expression:

  • Solubilization and Extraction Strategy:

    • Conduct systematic detergent screening to identify optimal solubilization conditions

    • Consider native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free extraction

    • Implement sequential extraction to separate properly folded protein from aggregates

  • Purification Approach:

    • Employ two-step affinity chromatography (e.g., IMAC followed by size exclusion)

    • Include a lipid mixture during purification to maintain native-like environment

    • Consider on-column refolding for proteins recovered from inclusion bodies

  • Protein Engineering Solutions:

    • Introduce thermostabilizing mutations identified through alanine scanning

    • Design constructs with minimal flexible regions to improve crystallization properties

    • Consider fusion proteins that have demonstrated success with other ArnE family members

  • Quality Control Metrics:

    • Monitor monodispersity using dynamic light scattering or analytical ultracentrifugation

    • Verify secondary structure using circular dichroism spectroscopy

    • Assess substrate binding capacity as a measure of functional integrity

  • Storage Stability Optimization:

    • Test various buffer compositions with specific lipid additions

    • Determine optimal protein:lipid:detergent ratios for long-term stability

    • Consider lyophilization protocols specifically developed for membrane proteins

Implementation of these methodological approaches has been shown to increase functional yield 3-5 fold while maintaining protein activity, which is crucial for downstream functional and structural studies.

What are the key considerations for designing expression vectors for recombinant arnE production?

When designing expression vectors for recombinant arnE production, researchers should consider multiple factors to maximize expression of functional protein:

  • Promoter Selection:

    • For prokaryotic systems: T7 promoter with lac operator for inducible expression

    • For eukaryotic systems: AOX1 (P. pastoris) or GAL1 (S. cerevisiae) for regulated expression

    • Consider leaky expression control for potentially toxic membrane proteins

  • Fusion Tag Strategy:

    • N-terminal tags: MBP, SUMO, or TrxA to enhance solubility

    • C-terminal tags: His6 or StrepII for purification

    • Inclusion of fluorescent protein fusions (GFP) for expression monitoring and folding assessment

    • Incorporation of TEV or PreScission protease cleavage sites for tag removal

  • Codon Optimization:

    • Adjust codon usage to match expression host while maintaining rare codons at critical folding junctures

    • Avoid extensive mRNA secondary structures, particularly near the translation initiation site

    • Consider harmonized codon usage rather than maximized codon optimization

  • Signal Sequences and Topology Control:

    • Include native signal sequences to direct proper membrane insertion

    • Consider topological control elements to ensure correct orientation in the membrane

    • Design constructs with minimal hydrophilic loops for crystallization studies

  • Regulatory Elements:

    • Strong ribosome binding sites for prokaryotic expression

    • Kozak sequences for eukaryotic expression

    • Transcription terminators to prevent read-through

These design considerations must be tailored to the specific experimental goals, whether focused on structural studies, functional characterization, or protein-protein interaction analysis of the arnE protein.

What experimental approaches can accurately measure the flippase activity of recombinant arnE?

Measuring the flippase activity of recombinant arnE requires specialized assays that can detect the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across membranes:

  • Fluorescence-Based Assays:

    • NBD-labeled lipid analogues to track substrate translocation

    • FRET-based assays using donor-acceptor pairs on opposite sides of the membrane

    • Stopped-flow kinetic analysis to measure real-time flipping rates

  • Biochemical Approaches:

    • Proteoliposome-based assays with radiolabeled substrates

    • Accessibility assays using membrane-impermeable reagents

    • Dithionite reduction assays for measuring transbilayer movement

  • Biophysical Methods:

    • Surface plasmon resonance to measure substrate binding kinetics

    • Solid-state NMR to observe substrate orientation changes

    • Neutron reflectometry to detect changes in membrane asymmetry

  • In Vitro Reconstitution Systems:

    • Giant unilamellar vesicles (GUVs) with reconstituted arnE for microscopy-based assays

    • Planar lipid bilayers for electrical measurements of flippase activity

    • Nanodiscs containing purified arnE for single-molecule studies

  • Cell-Based Reporter Systems:

    • Development of bacterial reporter strains sensitive to Ara4N modification

    • Fluorescence microscopy with membrane asymmetry-sensitive probes

    • Complementation assays in arnE-deficient strains

These methodologies provide complementary approaches to characterize the kinetics, substrate specificity, and regulatory factors affecting arnE flippase activity. When combined, they offer a comprehensive functional profile of this important membrane protein.

How does arnE contribute to antimicrobial resistance mechanisms in Serratia proteamaculans?

The arnE protein plays a critical role in antimicrobial resistance mechanisms in Serratia proteamaculans through its function in lipopolysaccharide (LPS) modification:

  • Mechanism of Action:

    • ArnE translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic face of the inner membrane

    • This translocation is essential for the subsequent transfer of Ara4N to lipid A

    • Modified lipid A with Ara4N reduces the net negative charge of LPS

  • Resistance to Cationic Antimicrobial Peptides (CAMPs):

    • Ara4N modification neutralizes negative charges on lipid A

    • Reduced electrostatic interaction with positively charged CAMPs

    • Increased survival against host immune defenses and therapeutic antimicrobial peptides

  • Polymyxin Resistance:

    • Ara4N-modified LPS shows 10-100 fold increased resistance to polymyxin antibiotics

    • Critical for survival in polymyxin-containing environments

    • The modification alters the three-dimensional conformation of LPS to prevent polymyxin binding

  • Regulatory Networks:

    • Expression of arnE is regulated through two-component systems (PhoP/PhoQ and PmrA/PmrB)

    • Environmental signals (pH, divalent cations, antimicrobial peptides) modulate arnE expression

    • Cross-talk with other resistance mechanisms provides coordinated defense

  • Horizontal Gene Transfer Considerations:

    • The arn operon can be transferred between bacterial species

    • Acquisition of functional arnE can rapidly confer resistance to new bacterial populations

    • Monitoring arnE presence serves as a marker for potential antimicrobial resistance

Understanding these resistance mechanisms has significant implications for developing new antimicrobial strategies that could potentially target the arnE flippase directly or its regulatory pathways.

What interaction partners and regulatory networks control arnE expression and function?

The expression and function of arnE in Serratia proteamaculans is controlled by complex regulatory networks and protein-protein interactions:

  • Two-Component Regulatory Systems:

    • PhoP/PhoQ system: Responds to Mg²⁺ limitation and acidic pH

    • PmrA/PmrB system: Responds to Fe³⁺ and acidic pH

    • Cross-regulation between these systems creates a complex response network

  • Transcriptional Regulators:

    • BglB family transcriptional antiterminator influences arnE expression

    • The catabolite regulation protein (CRP) indirectly regulates expression through global metabolic control

    • H-NS and other nucleoid-associated proteins may silence arnE expression under non-inducing conditions

  • Post-Transcriptional Regulation:

    • Small RNAs (sRNAs) potentially regulate arnE mRNA stability

    • RNA thermosensors may control translation initiation

    • GidA (glucose-inhibited division protein A) influences expression through tRNA modification

  • Protein-Protein Interactions:

    • ArnE likely functions in complex with ArnF to form a complete flippase

    • Interaction with other membrane proteins in the Arn pathway

    • Potential association with peptidoglycan synthesis machinery

  • Environmental and Metabolic Sensors:

    • Methyl-accepting chemotaxis proteins influence arnE expression

    • PIN domain proteins may regulate expression in response to stress conditions

    • Inosine/xanthosine triphosphatases affect expression through nucleotide pool modulation

The complex interplay between these regulatory elements creates a finely tuned system that responds to environmental stresses, particularly those encountered during host infection or antibiotic exposure. Experimental approaches to study these interactions include bacterial two-hybrid systems, co-immunoprecipitation followed by mass spectrometry, and chromatin immunoprecipitation to identify transcription factor binding sites.

How can recombinant arnE be utilized in screening for novel antimicrobial compounds?

Recombinant arnE can serve as a valuable tool for screening novel antimicrobial compounds through several strategic approaches:

  • High-Throughput Screening Platforms:

    • In vitro flippase activity assays using fluorescent substrates

    • Competitive binding assays to identify molecules that interfere with substrate recognition

    • FRET-based conformational change detection upon inhibitor binding

  • Structure-Based Virtual Screening:

    • In silico docking against predicted binding pockets in the arnE structure

    • Fragment-based drug design targeting critical residues in the translocation pathway

    • Molecular dynamics simulations to identify allosteric inhibition sites

  • Cellular Reporter Systems:

    • Engineered bacterial strains with arnE-dependent reporter gene expression

    • Fluorescence-based detection of LPS modification levels

    • Growth inhibition assays in combination with polymyxin antibiotics

  • Resistance Mechanism Studies:

    • Use of recombinant arnE to identify compounds that potentiate existing antibiotics

    • Evaluation of small molecules that disrupt the arnE-ArnF complex

    • Assessment of compounds that alter arnE localization in the membrane

  • Validation Methodologies:

    • Isothermal titration calorimetry to confirm direct binding

    • Surface plasmon resonance to determine binding kinetics

    • Crystallography or cryo-EM studies of arnE-inhibitor complexes

The development of arnE inhibitors could provide adjuvant therapies that restore sensitivity to polymyxins and host antimicrobial peptides in resistant bacteria, representing a potentially valuable approach to combating antimicrobial resistance.

What are the potential applications of arnE in studying bacterial membrane biogenesis?

Recombinant arnE provides a valuable model system for investigating fundamental aspects of bacterial membrane biogenesis:

  • Lipid Asymmetry Establishment:

    • arnE as a model flippase for understanding transmembrane lipid movement

    • Investigation of mechanisms maintaining inner membrane asymmetry

    • Studies on coordinated activity with lipid synthases and modifying enzymes

  • Membrane Protein Folding and Insertion:

    • Analysis of topogenic signals directing arnE membrane insertion

    • Studies on chaperone requirements for proper membrane integration

    • Investigation of lipid-protein interactions during folding

  • Membrane Domain Organization:

    • Examination of arnE localization in bacterial membrane microdomains

    • Studies on protein-protein interactions within functional membrane complexes

    • Analysis of lipid preferences and their impact on protein function

  • Membrane Remodeling During Stress:

    • Investigation of arnE role in adaptive membrane modifications

    • Analysis of membrane fluidity and permeability changes

    • Studies on coordination with envelope stress response systems

  • Experimental Tools for Membrane Biology:

    • Development of fluorescent or affinity-tagged arnE variants as membrane markers

    • Creation of conditional arnE expression systems to study membrane biogenesis dynamics

    • Engineering of arnE with altered substrate specificity to probe membrane composition requirements

These applications contribute to our fundamental understanding of bacterial physiology and potentially reveal new vulnerabilities that could be exploited for antimicrobial development targeting membrane biogenesis pathways.

How does the function of arnE compare with related flippases in other bacterial species?

Comparative analysis of arnE with related flippases across bacterial species reveals important evolutionary and functional relationships:

Bacterial SpeciesFlippase HomologSequence Identity to S. proteamaculans arnESubstrate SpecificityUnique Features
Yersinia pseudotuberculosisArnE~95%Ara4N-phosphoundecaprenol114 amino acids, 12.9 kDa
Escherichia coliArnE~70%Ara4N-phosphoundecaprenolFunctions as heterodimer with ArnF
Pseudomonas aeruginosaArnE~45%Ara4N-phosphoundecaprenolExtended C-terminal domain
Salmonella entericaArnE~75%Ara4N-phosphoundecaprenolConstitutive expression in some strains
Burkholderia cenocepaciaArnE~40%Ara4N-phosphoundecaprenolAdditional substrate capabilities

Key functional comparisons include:

  • Membrane Topology Differences:

    • Number and arrangement of transmembrane segments varies between species

    • Location and length of connecting loops shows species-specific adaptations

    • Conservation of critical charged residues in transmembrane regions

  • Substrate Recognition Mechanisms:

    • Species-specific differences in substrate binding pocket architecture

    • Variation in regions determining substrate specificity

    • Conservation of catalytic residues across diverse species

  • Regulation and Expression Patterns:

    • Differential integration into species-specific regulatory networks

    • Variation in promoter architecture and transcription factor binding sites

    • Species-dependent operon organization and co-transcription patterns

  • Functional Redundancy and Specialization:

    • Some species contain multiple arnE paralogs with specialized functions

    • Varying degrees of functional overlap with other lipid flippases

    • Species-specific accessory proteins modulating flippase activity

Evolutionary analysis suggests that while the core flippase mechanism is conserved, species-specific adaptations reflect unique ecological niches and antimicrobial resistance requirements.

How does arnE contribute to the pathogenic potential of Serratia proteamaculans?

The arnE protein contributes to Serratia proteamaculans pathogenesis through several mechanisms:

  • Host Defense Evasion:

    • LPS modification via arnE-mediated Ara4N incorporation reduces sensitivity to host antimicrobial peptides

    • Enhanced survival within phagocytic cells due to increased resistance to lysosomal antimicrobial peptides

    • Reduced activation of innate immune receptors that recognize LPS

  • Biofilm Formation:

    • LPS modifications alter surface properties affecting initial attachment

    • Changed cell surface hydrophobicity influences community structure

    • Modified outer membrane vesicle composition affects intercellular communication

  • Environmental Persistence:

    • Increased resistance to environmental stresses (pH, antimicrobial compounds)

    • Enhanced survival on surfaces in healthcare settings

    • Protection against predation by environmental protozoa

  • Relationship to Virulence Factors:

    • Coordinated regulation with protease production systems

    • S. proteamaculans produces cytotoxic proteases that contribute to pathogenesis

    • Connections between LPS modification and secretion system function

  • Tissue Invasion and Cytotoxicity:

    • S. proteamaculans strain 94 produces a 32-kDa thermostable protealysin with cytotoxic properties

    • This protease can cleave filamentous actin and matrix metalloprotease MMP2 in human cells

    • S. proteamaculans has demonstrated ability to invade human cells, with approximately 10% retention

These pathogenic mechanisms highlight the importance of arnE in bacterial virulence and suggest potential therapeutic approaches targeting this system to attenuate S. proteamaculans infections.

What therapeutic applications might emerge from studies of recombinant arazyme from Serratia proteamaculans?

Studies of recombinant arazyme from Serratia proteamaculans have revealed promising therapeutic applications:

  • Anti-cancer Applications:

    • Recombinant arazyme demonstrates significant cytotoxic effects against MCF-7 and SKOV3 cancer cell lines in a dose-dependent manner

    • It induces apoptosis through activation of caspase-3 and elevation of the BAX/BCL-2 ratio

    • The enzyme significantly decreases expression of angiogenesis-related genes VEGFR-1 and VEGFR-2

    • It inhibits both cell adhesion and invasion, suggesting potential anti-metastatic properties

  • Mechanisms of Action:

    • Proteolytic modification of cell surface receptors

    • Disruption of extracellular matrix components

    • Activation of pro-apoptotic signaling cascades

    • Interference with angiogenesis signaling pathways

  • Delivery System Development:

    • Enzyme-polymer conjugates for improved stability

    • Targeted nanoparticle formulations for cancer-specific delivery

    • Modified recombinant versions with enhanced tissue penetration

    • PEGylated derivatives with improved pharmacokinetic profiles

  • Combination Therapy Potential:

    • Synergistic effects with conventional chemotherapeutics

    • Use as a sensitizing agent for radiation therapy

    • Combination with immune checkpoint inhibitors

    • Application in enzyme-prodrug therapy approaches

  • Future Research Directions:

    • Structure-function studies to identify critical domains for therapeutic activity

    • Development of recombinant variants with enhanced specificity

    • In vivo efficacy studies in animal models of cancer

    • Investigation of potential immunomodulatory effects

These findings suggest that recombinant arazyme from S. proteamaculans may play an essential role in the development of effective therapies against ovarian and breast cancers, potentially reducing treatment side effects through more targeted approaches .

What advanced molecular techniques can be applied to study the role of arnE in bacterial resistance mechanisms?

Investigating arnE's role in bacterial resistance mechanisms requires sophisticated molecular approaches:

  • Genome Editing Technologies:

    • CRISPR-Cas9 for precise gene modification and regulatory element targeting

    • Recombineering approaches for seamless chromosomal modifications

    • Site-directed mutagenesis to create point mutations in functional domains

    • Creation of conditional expression systems using inducible promoters

  • High-Resolution Microscopy:

    • Super-resolution microscopy to visualize membrane localization

    • FRET-based approaches to detect protein-protein interactions

    • Single-molecule tracking to monitor dynamics in living cells

    • Correlative light and electron microscopy for structure-function analysis

  • Systems Biology Approaches:

    • RNA-Seq to analyze transcriptional changes in arnE mutants

    • Quantitative proteomics to identify changes in protein expression

    • Metabolomics to detect alterations in lipid composition

    • Network analysis to identify regulatory hubs controlling arnE expression

  • Advanced Biochemical Methods:

    • Hydrogen-deuterium exchange mass spectrometry for conformational studies

    • Native mass spectrometry to analyze intact membrane protein complexes

    • Lipid mass spectrometry to quantify changes in membrane composition

    • Crosslinking mass spectrometry to map protein interaction networks

  • In Vivo Infection Models:

    • Fluorescent reporter strains to track arnE expression during infection

    • Competitive infection assays with wild-type and arnE mutants

    • Host-microbe interaction models to study resistance to antimicrobial peptides

    • Single-cell analysis of bacterial populations during antibiotic challenge

Implementation of these advanced techniques provides comprehensive insights into arnE function and regulation, particularly within the context of antimicrobial resistance mechanisms and bacterial pathogenesis.

What are the most promising future research directions for studying arnE in Serratia proteamaculans?

Future research on arnE in Serratia proteamaculans should focus on several promising directions:

  • Structural Biology Studies:

    • Determination of high-resolution crystal or cryo-EM structures of arnE alone and in complex with substrates or inhibitors

    • Analysis of conformational changes during the flipping mechanism

    • Comparative structural analysis with homologs from other bacterial species

  • Development of Specific Inhibitors:

    • Structure-based design of small molecule inhibitors targeting arnE

    • Peptide-based inhibitors mimicking substrate binding sites

    • Allosteric modulators affecting arnE-ArnF interactions

  • Systems-Level Analysis:

    • Integration of arnE function into whole-cell models of bacterial envelope biogenesis

    • Network analysis of regulatory connections between antimicrobial resistance mechanisms

    • Multi-omics approaches to understand global impacts of arnE modulation

  • Translational Research:

    • Evaluation of arnE inhibitors as adjuvants for existing antibiotics

    • Development of diagnostic tools detecting arnE expression as markers of resistance

    • Investigation of recombinant arazyme's potential in cancer therapy

  • Evolutionary Studies:

    • Analysis of selective pressures driving arnE evolution

    • Horizontal gene transfer patterns of the arn operon

    • Comparative genomics of arnE variants across different Serratia species

These research directions promise to advance our understanding of bacterial membrane biology, antimicrobial resistance mechanisms, and potential therapeutic applications of arnE-derived proteins or inhibitors.

What methodological challenges remain in studying membrane proteins like arnE?

Despite advances in membrane protein research, significant methodological challenges remain for studying proteins like arnE:

  • Expression and Purification Limitations:

    • Low expression yields compared to soluble proteins

    • Difficulty maintaining native conformation during solubilization

    • Challenges in selecting appropriate detergent systems

    • Protein instability during purification procedures

  • Structural Determination Barriers:

    • Challenges in growing diffraction-quality crystals

    • Limited resolution in cryo-EM studies of small membrane proteins

    • Difficulties in NMR studies due to size limitations and detergent interference

    • Challenges in capturing different conformational states

  • Functional Assay Complexities:

    • Creating artificial membrane systems that reflect native environments

    • Developing high-throughput assays for flippase activity

    • Distinguishing substrate binding from actual translocation events

    • Reconstituting multi-component membrane protein complexes

  • In Vivo Analysis Difficulties:

    • Challenges in specifically labeling membrane proteins in living cells

    • Difficulties distinguishing direct from indirect effects in genetic studies

    • Limited tools for studying protein dynamics in native membranes

    • Complexities in interpreting phenotypes of membrane protein mutants

  • Computational Challenges:

    • Limitations in accurately modeling membrane protein-lipid interactions

    • Computational cost of simulating membrane environments

    • Challenges in predicting membrane protein structures from sequence

    • Difficulties in modeling conformational transitions during substrate translocation

Addressing these methodological challenges requires interdisciplinary approaches combining expertise in biochemistry, biophysics, computational biology, and advanced imaging techniques.

How might understanding arnE function contribute to broader concepts in bacterial cell envelope biology?

Understanding arnE function has broader implications for bacterial cell envelope biology:

  • Membrane Asymmetry Maintenance:

    • Insights into mechanisms establishing and maintaining lipid asymmetry

    • Understanding of coordinated actions between flippases, floppases, and scramblases

    • Models for how bacteria regulate envelope composition in response to stress

  • Resistance Mechanism Integration:

    • Connections between different envelope modification systems

    • Understanding of how bacterial cells coordinate multiple resistance mechanisms

    • Insights into evolutionary adaptations of envelope structure

  • Cell Division and Growth:

    • Role of phospholipid flipping in membrane expansion during growth

    • Coordination between envelope modification and cell division machinery

    • Spatial regulation of envelope biogenesis components

  • Bacterial Stress Responses:

    • Integration of envelope modification into general stress response networks

    • Sensing mechanisms that detect envelope damage or antimicrobial presence

    • Temporal regulation of resistance mechanism deployment

  • Host-Pathogen Interactions:

    • Role of modified bacterial surfaces in immune evasion strategies

    • Impact of envelope modifications on bacterial adhesion and invasion

    • Influence of host environment on bacterial envelope composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.