Recombinant Serratia proteamaculans Probable intracellular septation protein A (Spro_2677)

What is Serratia proteamaculans and what cellular functions does the intracellular septation protein A (Spro_2677) serve?

Serratia proteamaculans is a gram-negative, rod-shaped bacterium belonging to the Enterobacteriaceae family. It possesses a LuxI/LuxR type Quorum Sensing (QS) system consisting of regulatory protein SprR and AHL synthase SprI, which regulates gene expression in response to changes in bacterial population density . As a facultative pathogen, this bacterium demonstrates invasive activity during the stationary growth phase and produces various extracellular enzymes including chitinase, endoglucanase, protease, and laccase .

The intracellular septation protein A (Spro_2677) is predicted to play a critical role in bacterial cell division processes. Based on sequence analysis, Spro_2677 contains 179 amino acids and likely functions in the formation of the septum during bacterial division. Methodologically, researchers can investigate its function through gene knockout studies followed by microscopic analysis of cell morphology and division patterns, complemented by fluorescent protein tagging to visualize its localization during the cell cycle.

How can researchers effectively express and purify recombinant Spro_2677?

Expression and purification of recombinant Spro_2677 requires careful optimization due to its predicted membrane-associated nature. A recommended methodological approach follows:

• Expression system selection: Use E. coli BL21(DE3) with a pET vector system containing a His-tag or other affinity tag for simplified purification.

• Growth conditions: Culture at 18-25°C post-induction to reduce inclusion body formation, which is common with membrane proteins.

• Induction parameters: Test IPTG concentrations (0.1-1.0 mM) and induction duration (4-16 hours) to optimize expression.

• Cell lysis: Employ gentle disruption methods using enzymatic lysis buffers containing lysozyme.

• Membrane protein extraction: Use mild detergents (DDM, LDAO, or Triton X-100) for solubilization.

• Purification strategy: Apply immobilized metal affinity chromatography (IMAC) using Ni-NTA or cobalt-based resins, followed by size exclusion chromatography.

• Storage conditions: Maintain in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

For recombinant Spro_2677, specific care must be taken regarding detergent selection during membrane protein extraction, as inappropriate detergents can affect protein folding and function. Additionally, researchers should validate protein purity through SDS-PAGE and verify functionality through activity assays where applicable.

What experimental approaches can confirm the localization of Spro_2677 within bacterial cells?

To definitively determine the subcellular localization of Spro_2677, researchers should employ a multi-method approach:

• Fluorescent protein fusion imaging: Generate C- or N-terminal GFP/mCherry fusions with Spro_2677 and observe localization via fluorescence microscopy throughout the cell cycle. For septation proteins, visualization during different stages of division is particularly informative.

• Immunofluorescence microscopy: Use antibodies specific to Spro_2677 or its epitope tag for fixed-cell immunolocalization studies.

• Subcellular fractionation: Separate bacterial cytoplasmic, membrane, and periplasmic fractions followed by Western blot analysis to determine which fraction contains Spro_2677.

• Cryo-electron microscopy: Apply for high-resolution visualization of the protein in its cellular context.

• Super-resolution microscopy techniques: Implement STORM or PALM for nanometer-scale localization precision, particularly useful for visualizing septation dynamics.

The membrane-associated nature of Spro_2677 indicated by its sequence suggests it would likely localize to the division septum during cell division. Time-lapse imaging using the above techniques would be particularly valuable to understand its dynamic behavior during the bacterial cell cycle.

How does the Spro_2677 protein interact with other components of the bacterial cell division machinery?

Investigating Spro_2677's interactions with other divisome components requires sophisticated protein-protein interaction methodologies:

• Bacterial two-hybrid assays: Screen for interactions between Spro_2677 and known divisome components (FtsZ, FtsA, ZipA, FtsK, etc.). This approach can be modeled after the yeast-based protein-protein interaction assay described for IpaC and β-catenin, where a prey protein is tagged with mCherry and a bait protein is fused to a reovirus scaffold protein that forms inclusion bodies .

• Co-immunoprecipitation studies: Use tagged versions of Spro_2677 to pull down interacting proteins, followed by mass spectrometry identification.

• Cross-linking mass spectrometry: Apply chemical cross-linking followed by LC-MS/MS to identify proteins in close proximity to Spro_2677 in vivo.

• FRET or BRET assays: Measure energy transfer between fluorescently labeled Spro_2677 and potential interaction partners to confirm direct interactions.

• Split-GFP complementation: Engineer Spro_2677 and candidate partners with complementary GFP fragments to visualize interactions in living cells.

Data analysis should include quantification of interaction strengths, determination of binding domains, and correlation with cell division phases. Researchers should also consider how these interactions might be regulated by environmental factors or growth conditions relevant to Serratia proteamaculans ecology.

What is the relationship between Spro_2677 and bacterial pathogenicity mechanisms?

While direct evidence linking Spro_2677 to pathogenicity is limited in the available literature, several methodological approaches can investigate this potential connection:

• Comparative virulence studies: Create Spro_2677 deletion mutants and assess changes in virulence using appropriate infection models. The approach used to study protease activity in Serratia sp. strain SCBI could serve as a model, where miniHimar RB1 transposon mutants were screened and assessed for cytotoxicity, virulence, motility, and hemolysis .

• Transcriptomic analysis: Implement RNA-seq to compare gene expression profiles between wild-type and ΔSpro_2677 strains during infection, similar to the transcriptome analysis performed for protease-defective mutants .

• Host cell interaction assays: Evaluate adhesion, invasion, and intracellular survival capabilities using human cell lines such as HEp-2, which have been used to study S. proteamaculans invasion .

• Proteomic analysis: Identify changes in secreted protein profiles between wild-type and ΔSpro_2677 strains using LC-MS/MS.

The invasive activity of S. proteamaculans appears at the stationary growth phase corresponding to maximal bacterial population density . Since Spro_2677 is involved in cell division, it might indirectly affect pathogenicity by influencing growth dynamics. Additionally, S. proteamaculans strain 94 has been shown to invade human larynx carcinoma HEp-2 cells , suggesting that proteins involved in cell structure and division may contribute to this invasive phenotype.

How do environmental conditions affect the expression and activity of Spro_2677?

To investigate environmental regulation of Spro_2677, researchers should employ the following systematic approach:

• qRT-PCR analysis: Quantify Spro_2677 mRNA levels under various conditions (temperature, pH, nutrient availability, growth phase, iron limitation) similar to the qRT-PCR approach used to characterize protease gene expression in Serratia sp. SCBI .

• Reporter gene fusions: Create transcriptional and translational fusions of the Spro_2677 promoter and coding sequence with reporter genes (GFP, luciferase) to monitor expression in real-time.

• Differential proteomics: Compare protein levels under different environmental conditions using quantitative proteomics.

• Chromatin immunoprecipitation (ChIP): Identify transcription factors that bind to the Spro_2677 promoter region under various conditions.

Table 1: Hypothetical expression patterns of Spro_2677 under varying environmental conditions

This approach is particularly relevant given that S. proteamaculans has a Quorum Sensing system that regulates gene expression in response to population density changes , and environmental factors like iron limitation have been shown to affect bacterial invasion mechanisms .

What structure-function relationships exist within the Spro_2677 protein?

To elucidate structure-function relationships in Spro_2677, researchers should implement the following methodological framework:

• Domain identification: Apply bioinformatic tools to identify conserved domains, transmembrane regions, and functional motifs within the 179-amino acid sequence .

• Site-directed mutagenesis: Create a series of point mutations targeting:

  • Conserved residues across homologous proteins

  • Predicted functional motifs

  • Hydrophobic regions likely involved in membrane association

  • Charged residues potentially involved in protein-protein interactions

• Truncation analysis: Generate N- and C-terminal truncations to identify minimal functional domains.

• Functional complementation: Test mutant variants for their ability to restore normal phenotypes in a ΔSpro_2677 background.

• Protein stability and localization: Assess how mutations affect protein stability and proper localization within the cell.

Specific attention should be paid to the hydrophobic regions in the sequence (LIVFFAFYKLYDIYVASGALIVATALALVFTWFKY and similar sections) , which likely facilitate membrane integration and may be essential for proper function. The C-terminal region containing charged residues (YIYRHMPEEQKK) may be involved in protein-protein interactions and represents another target for mutational analysis.

What techniques can be used to study the dynamics of Spro_2677 during the bacterial cell cycle?

To investigate the temporal dynamics of Spro_2677 during cell division, researchers should implement these advanced methodological approaches:

• Time-lapse fluorescence microscopy: Track GFP-tagged Spro_2677 during the entire cell cycle using microfluidic devices to maintain consistent growth conditions.

• Photoactivatable fluorescent proteins: Use photoactivatable tags to pulse-label Spro_2677 and track the labeled pool over time.

• Single-molecule tracking: Apply techniques like PALM or sptPALM to follow individual Spro_2677 molecules during division.

• Fluorescence recovery after photobleaching (FRAP): Assess protein mobility and turnover rates at the division site.

• Cell-cycle synchronized cultures: Use methods to synchronize bacterial populations (e.g., nutrient shift, temperature-sensitive division mutants) and analyze Spro_2677 levels and localization at specific cycle stages.

• Quantitative Western blotting: Measure Spro_2677 protein levels throughout the cell cycle.

• ChIP-seq timing analysis: Determine if Spro_2677 associates with specific chromosomal regions during different cell cycle stages.

These approaches should be combined with simultaneous visualization of known cell division markers (like FtsZ) to correlate Spro_2677 dynamics with specific stages of the division process. This is particularly relevant since Spro_2677 is annotated as an intracellular septation protein , suggesting a direct role in the formation of the division septum.

How does Spro_2677 compare to septation proteins in other bacterial species?

Comparative analysis of Spro_2677 with septation proteins from other bacterial species provides evolutionary and functional insights. Researchers should employ:

• Phylogenetic analysis: Construct phylogenetic trees of Spro_2677 homologs across bacterial species to identify evolutionary relationships.

• Multiple sequence alignment: Identify conserved residues and domains that may be functionally significant.

• Structural homology modeling: Generate 3D structural models based on crystallized homologs to predict functional sites.

• Complementation studies: Test whether Spro_2677 can functionally replace septation proteins in other bacterial species.

Table 2: Comparison of predicted functional characteristics between Spro_2677 and septation proteins from model organisms

This comparative approach can identify unique features of Spro_2677 that may contribute to specific aspects of S. proteamaculans biology, such as its ability to invade human cells or adapt to various ecological niches.

What experimental approaches can elucidate the role of Spro_2677 in bacterial stress responses?

To investigate Spro_2677's potential role in stress responses, researchers should implement:

• Stress challenge assays: Compare survival rates of wild-type and ΔSpro_2677 strains under various stresses (oxidative, osmotic, temperature, antibiotic).

• Microscopic analysis: Examine morphological changes in mutant vs. wild-type cells under stress conditions.

• Transcriptome comparison: Perform RNA-seq to identify differentially expressed genes in response to stress between wild-type and mutant strains.

• Protein interaction studies during stress: Identify stress-specific interaction partners using techniques like BioID or proximity-dependent labeling.

• Proteomic stability analysis: Determine if Spro_2677 undergoes degradation or post-translational modifications during stress responses.

This research direction is particularly relevant given that S. proteamaculans has shown adaptability to various environmental conditions, including iron limitation which affects its invasive properties . Cell division proteins often play dual roles in stress responses, and Spro_2677 may contribute to S. proteamaculans' ability to thrive in diverse ecological niches.

How can researchers effectively study post-translational modifications of Spro_2677?

For comprehensive analysis of post-translational modifications (PTMs) affecting Spro_2677, researchers should employ:

• Mass spectrometry-based PTM mapping: Use high-resolution LC-MS/MS to identify phosphorylation, acetylation, methylation, and other modifications.

• Site-directed mutagenesis: Mutate identified PTM sites to non-modifiable residues and assess functional consequences.

• Phosphoproteomic analysis: Compare phosphorylation patterns under different growth conditions.

• Western blotting with modification-specific antibodies: Track specific PTMs during various growth phases.

• In vitro modification assays: Identify kinases, acetyltransferases, or other enzymes responsible for Spro_2677 modifications.

• Stability assays: Determine how PTMs affect Spro_2677 turnover rates using pulse-chase experiments.

These approaches are relevant to understanding how Spro_2677 function might be regulated during different growth phases or environmental conditions, which is particularly important given that S. proteamaculans shows phase-dependent behaviors like increased invasive activity during stationary phase .

What are the most promising future research directions for Spro_2677?

Based on current knowledge about S. proteamaculans and Spro_2677, several high-priority research directions emerge:

• Structural biology: Determining the high-resolution structure of Spro_2677 would provide invaluable insights into its function and interactions.

• Host-pathogen interactions: Investigating whether Spro_2677 contributes to S. proteamaculans' ability to invade human cells could reveal new pathogenicity mechanisms.

• Environmental adaptation: Studying how Spro_2677 contributes to survival in diverse environments, particularly in decomposed wood where S. proteamaculans has been isolated .

• Biotechnological applications: Exploring whether structural understanding of Spro_2677 could inform development of new antimicrobial targets.

• Systems biology: Integrating Spro_2677 into models of S. proteamaculans' regulatory networks, particularly in relation to quorum sensing systems .

These research directions should be pursued using interdisciplinary approaches combining genetics, biochemistry, structural biology, and computational methods to develop a comprehensive understanding of this bacterial protein's role in cellular physiology and potentially pathogenesis.

What are the best protocols for generating and validating Spro_2677 knockout mutants?

Creating and validating Spro_2677 knockout mutants requires careful methodological considerations:

• Knockout strategy selection:

  • Homologous recombination using suicide vectors

  • CRISPR-Cas9 genome editing

  • Transposon mutagenesis screening (as used for protease studies in Serratia )

• Confirmation methods:

  • PCR verification of the deletion

  • Whole-genome sequencing to confirm deletion and absence of off-target effects

  • qRT-PCR to verify absence of mRNA expression

  • Western blotting to confirm protein absence

  • Complementation testing to ensure phenotypes are specifically due to the deletion

• Phenotypic characterization:

  • Growth curves in various media

  • Cell morphology analysis using phase contrast and electron microscopy

  • Division dynamics using time-lapse microscopy

  • Stress response assays

  • Virulence testing in appropriate models

The miniHimar RB1 transposon mutagenesis approach used to identify protease-defective mutants in Serratia sp. SCBI provides a methodological framework that could be adapted for Spro_2677 studies.

How can researchers effectively differentiate the specific functions of Spro_2677 from those of other septation proteins?

To distinguish the specific functions of Spro_2677 from other septation proteins, researchers should implement:

• Double knockout studies: Create mutants lacking both Spro_2677 and other septation proteins to identify synthetic interactions or redundancies.

• Domain swapping experiments: Replace domains of Spro_2677 with corresponding regions from other septation proteins to identify functional equivalences.

• Temporal expression analysis: Determine the precise timing of Spro_2677 expression relative to other septation proteins during the cell division cycle.

• Super-resolution co-localization: Use multi-color super-resolution microscopy to determine spatial relationships between Spro_2677 and other divisome components.

• Biochemical activity assays: Develop in vitro assays to characterize specific enzymatic or structural activities of Spro_2677.

• Cross-species complementation: Test whether septation proteins from other bacteria can restore normal phenotypes in ΔSpro_2677 S. proteamaculans.