Recombinant Serratia proteamaculans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Serratia proteamaculans Prolipoprotein Diacylglyceryl Transferase (LGT)

Recombinant Serratia proteamaculans Prolipoprotein Diacylglyceryl Transferase (LGT) is a bioengineered enzyme used to study bacterial lipoprotein biosynthesis and membrane integrity. LGT catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, a critical step in lipoprotein maturation in Gram-negative bacteria . This enzyme is essential for bacterial viability, as its inhibition disrupts membrane structure and leads to cell death .

Enzyme Architecture

LGT is an inner membrane protein with seven transmembrane segments, exposing its N-terminus to the periplasm and C-terminus to the cytoplasm . Key conserved residues critical for catalysis include:

ResidueRole in ActivityConserved Motif
Y26Essential for catalysisLgt signature motif
N146Critical for substrate bindingMembrane-embedded region
G154Stabilizes active site conformationLgt signature motif
R143, E151, R239, E243Support catalytic functionMembrane-associated residues

These residues are part of a conserved Lgt signature motif (H-103-GGLIG-108), shared across Gram-negative bacteria .

Sequence Similarity

Serratia proteamaculans LGT shares 24% identity with LGT from E. coli, Salmonella typhimurium, and Haemophilus influenzae, with 47% similarity in amino acid sequences . Structural features like hydropathic profiles and predicted pI (~10.4) align with E. coli LGT, despite being 12 amino acids shorter .

Recombinant Expression Systems

Recombinant LGT is produced in heterologous hosts such as E. coli or yeast, with reported >85% purity via SDS-PAGE . Key production details include:

ParameterValueSource
Expression HostE. coli or yeast
Purity>85%SDS-PAGE
TagsNot specified (determined during manufacturing)
Storage-20°C/-80°C (liquid/lyophilized)

Biochemical Assays

LGT activity is measured in vitro using luciferase-based assays or SDS-PAGE fractionation to detect unmodified prolipoproteins (UPLP) . Inhibition studies with macrocyclic peptides (e.g., G2824) demonstrate dose-dependent inhibition of LGT, validated via accumulation of UPLP .

Antibacterial Target Validation

LGT inhibition disrupts bacterial membrane integrity, leading to:

  • Loss of viability at ~25% enzyme depletion .

  • Increased antibiotic sensitivity due to compromised outer membrane (OM) permeability .

  • Accumulation of UPLP, confirmed via SDS-PAGE and Western blotting .

Inhibitor Screening

Macrocyclic peptides like G2824 (MW: 1428.66 Da) bind LGT with high affinity, blocking its function . Key findings include:

InhibitorMechanismIC₅₀
G2824Competitive inhibition~4.4 μM
G9066Non-competitive inhibitionN/A

These inhibitors do not rescue growth in lpp-deleted strains, unlike inhibitors targeting downstream enzymes (e.g., LspA) .

Sequence Conservation

SpeciesSequence Identity (%)Source
E. coli24
Salmonella typhimurium24
Haemophilus influenzae24
Pseudomonas aeruginosa51.6
Acinetobacter baumannii48.6

Functional Parallels

LGT’s role in lipoprotein modification is conserved across Gram-negative bacteria, but structural divergence (e.g., shorter length in Serratia) suggests species-specific adaptations .

Essentiality and Resistance

LGT inhibition does not accumulate peptidoglycan (PGN)-linked lipoproteins, unlike downstream enzyme inhibitors . This reduces resistance mechanisms such as lpp deletion rescue .

Therapeutic Implications

Targeting LGT avoids common resistance strategies (e.g., OM remodeling), making it a novel antibacterial target .

Future Research Directions

  • Structural Studies: Cryo-EM of LGT-inhibitor complexes to elucidate binding modes.

  • Species-Specific Inhibitors: Design analogs targeting Serratia-specific residues.

  • Synergistic Therapies: Combine LGT inhibitors with β-lactams or aminoglycosides to exploit OM permeability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Spro_3822; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
lgt
Target Protein Sequence
MTNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKDEVENL LYAGFLGVFVGGRVGYVLFYNLPLFMENPLYLFKVWDGGMSFHGGLMGVILVMFWFARRT KRTFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVTTDTPWAMLFPSSRAEDVALAAAD PKLLPILNQYGVLPRHPSQLYELLLEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEAFRQPDAQLGLFDGVISMGQILSVPMVVAGIIMMIWAYRRRPQQQLS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the "lipobox" of prolipoproteins, forming a thioether bond . This modification is essential for the proper localization and function of bacterial lipoproteins, which play critical roles in cell envelope architecture, transport, adhesion, and virulence . In Gram-negative bacteria such as Serratia proteamaculans, the deletion of the lgt gene is typically lethal, highlighting its essential nature for bacterial survival .

How does S. proteamaculans Lgt compare structurally to E. coli Lgt?

While the specific crystal structure of S. proteamaculans Lgt has not been fully characterized in the provided search results, structural insights can be gained from the well-studied E. coli Lgt. The E. coli Lgt crystal structure has been resolved at high resolution (1.9 Å and 1.6 Å) in complex with phosphatidylglycerol and the inhibitor palmitic acid . The structure reveals two binding sites that are critical for its function. Based on the evolutionary conservation of Lgt across Gram-negative bacteria, S. proteamaculans Lgt likely shares significant structural similarities with its E. coli counterpart, particularly in the catalytic domain and substrate binding sites. Both enzymes would be expected to contain the conserved arginine residues (such as Arg143 and Arg239 in E. coli) that are essential for diacylglyceryl transfer activity .

What is the relationship between Lgt and bacterial virulence in S. proteamaculans?

In S. proteamaculans, Lgt contributes to virulence by ensuring proper processing of lipoproteins that are involved in various pathogenic mechanisms. Research indicates that S. proteamaculans is capable of invading eukaryotic cells, with several virulence factors contributing to this invasive activity . While the intracellular metalloprotease protealysin has been identified as a primary virulence factor, other factors such as pore-forming hemolysin ShlA and extracellular metalloprotease serralysin also contribute significantly to invasive capability . The lipid modifications mediated by Lgt are likely essential for the proper localization and function of these virulence-associated lipoproteins in the bacterial cell envelope. Inhibition of Lgt activity leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics, further highlighting its importance in maintaining bacterial pathogenicity .

What are the most effective methods for expressing and purifying recombinant S. proteamaculans Lgt?

For the successful expression and purification of recombinant S. proteamaculans Lgt, researchers should consider the following methodological approach:

  • Expression System Selection: Given that Lgt is an integral membrane protein, specialized expression systems designed for membrane proteins are recommended. E. coli BL21(DE3) or C43(DE3) strains are often used for expressing membrane proteins.

  • Vector Design: The lgt gene should be cloned into an expression vector containing an appropriate promoter (such as T7) and a fusion tag (such as GST or His-tag) to facilitate purification. Based on the research with E. coli Lgt, a GST-fusion construct has been demonstrated to be effective .

  • Protein Extraction: Since Lgt is a membrane protein, membrane fraction isolation followed by detergent solubilization is necessary. Common detergents include n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG).

  • Purification Protocol: Affinity chromatography based on the fusion tag (GST or His-tag) followed by size exclusion chromatography is recommended for obtaining pure protein. For GST-tagged constructs, glutathione-agarose resin can be used .

  • Quality Control: The purified protein should be assessed for purity using SDS-PAGE and for activity using the enzymatic assay that measures diacylglyceryl transfer.

Researchers should note that the GST-tagged constructs of Lgt have been shown to maintain enzymatic activity, suggesting that this approach is viable for functional studies .

How can I design a reliable assay to measure S. proteamaculans Lgt enzymatic activity?

A reliable assay for measuring S. proteamaculans Lgt enzymatic activity can be designed based on the detection of glycerol phosphate released during the diacylglyceryl transfer reaction. The following methodological approach is recommended:

  • Substrate Preparation: Use a synthetic peptide substrate derived from a lipoprotein signal sequence containing the conserved cysteine residue. For example, a peptide derived from the Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine) has been successfully used for E. coli Lgt .

  • Reaction Components:

    • Purified recombinant Lgt

    • Synthetic peptide substrate

    • Phosphatidylglycerol (substrate for diacylglyceryl donor)

    • Appropriate buffer system (typically pH 7.4-8.0)

    • Divalent cations (Mg²⁺ or Mn²⁺) if required

  • Detection Method: The Lgt-catalyzed reaction results in the release of glycerol phosphate (G1P or G3P depending on the phosphatidylglycerol substrate) . This can be detected using:

    • A coupled enzymatic assay with glycerol phosphate oxidase and horseradish peroxidase

    • A luciferase-based detection system for high sensitivity

    • Colorimetric phosphate detection methods

  • Quantification: Standard curves should be established using known concentrations of glycerol phosphate to quantify the enzyme activity. Activity can be expressed as moles of glycerol phosphate released per unit time per amount of enzyme.

  • Controls: Include negative controls (no enzyme or denatured enzyme) and positive controls (well-characterized Lgt from another species, such as E. coli).

This assay can be adapted for inhibitor screening by including test compounds and measuring the reduction in enzymatic activity .

What experimental design considerations are crucial when studying the regulatory mechanisms of Lgt expression?

When investigating the regulatory mechanisms of Lgt expression in S. proteamaculans, several experimental design considerations are critical:

  • Hypothesis Formulation: Clearly define the regulatory mechanism to be studied, whether it's transcriptional, translational, or post-translational regulation .

  • Growth Conditions:

    • Test multiple growth conditions, including variations in:

      • Nutrient availability

      • Iron limitation (which has been shown to affect virulence factor expression in S. proteamaculans)

      • Growth phase (particularly stationary phase when quorum sensing is activated)

      • Environmental stressors

  • Genetic Manipulation Approaches:

    • Generate knockout mutants of potential regulatory genes

    • Create reporter gene fusions (e.g., lgt promoter fused to GFP or luciferase)

    • Use inducible expression systems to control gene expression

  • Quorum Sensing Investigation: Since S. proteamaculans possesses a LuxI/LuxR type quorum sensing system (SprI/SprR) that regulates virulence factors, assess the impact of this system on Lgt expression .

    • Use SprI or SprR mutants

    • Add exogenous acyl-homoserine lactones (AHLs)

    • Monitor expression throughout growth phases

  • Measurement Methods:

    • RT-qPCR for mRNA levels

    • Western blotting for protein levels

    • Activity assays for functional enzyme levels

    • Reporter gene expression for promoter activity

  • Statistical Analysis:

    • Ensure appropriate replication (minimum 3-5 biological replicates)

    • Select appropriate statistical tests based on data distribution

    • Consider blocking and randomization to control for confounding variables

  • Controls:

    • Include positive and negative controls for each experimental condition

    • Use housekeeping genes as internal controls for expression studies

This systematic approach will help ensure robust and reproducible results when investigating the regulatory mechanisms controlling Lgt expression in S. proteamaculans.

How does the quorum sensing system in S. proteamaculans influence Lgt activity and lipoprotein processing?

The quorum sensing (QS) system in S. proteamaculans plays a significant role in regulating gene expression in response to bacterial population density, which may influence Lgt activity and lipoprotein processing. S. proteamaculans possesses a LuxI/LuxR type QS system consisting of the regulatory protein SprR and the acyl-homoserine lactone (AHL) synthase SprI .

Research has demonstrated that inactivation of the AHL synthase sprI gene results in a more than fourfold increase in the invasive activity of S. proteamaculans . This enhanced invasion is preceded by increased bacterial adhesion to the cell surface and correlates with increased expression of the outer membrane protein ompX gene . Simultaneously, there is a decrease in the activity of intrabacterial protease protealysin, which uses OmpX as a substrate .

The relationship between QS and Lgt activity likely involves complex regulatory networks:

The inverse correlation observed between protealysin activity and bacterial invasion under iron-limiting conditions suggests that environmental factors further modulate this QS-dependent regulation. Understanding these complex regulatory networks is crucial for developing strategies to target Lgt as a potential therapeutic target.

What are the structural and functional differences between Lgt from S. proteamaculans and other bacterial species?

Lgt is a highly conserved enzyme across bacterial species, but structural and functional differences exist that may be relevant for species-specific targeting. Based on the available research, several key differences and similarities can be identified:

Structural Characteristics:

  • Binding Sites: E. coli Lgt crystal structures reveal two binding sites , which are likely conserved in S. proteamaculans Lgt, but may have species-specific amino acid variations that affect substrate specificity or inhibitor binding.

  • Critical Residues: In E. coli, residues Arg143 and Arg239 are essential for diacylglyceryl transfer . Comparison of these residues across species may reveal subtle differences that affect enzyme catalysis or regulation.

  • Membrane Topology: As integral membrane proteins, Lgt enzymes from different species may have variations in their membrane-spanning domains that affect their interaction with the lipid bilayer and substrate accessibility.

Functional Differences:

  • Substrate Specificity: While the basic mechanism of diacylglyceryl transfer is conserved, S. proteamaculans Lgt may have different preferences for phospholipid donors or prolipoprotein substrates compared to other species.

  • Regulatory Control: The regulation of Lgt expression and activity varies across species. In S. proteamaculans, the quorum sensing system influences virulence factor expression , which may extend to Lgt regulation in ways that differ from other bacteria.

  • Environmental Responsiveness: S. proteamaculans shows enhanced invasive activity under iron-limiting conditions , which may involve alterations in Lgt activity or expression that are not observed in other species.

  • Inhibitor Sensitivity: Recently identified Lgt inhibitors show activity against E. coli and A. baumannii Lgt , but their effectiveness against S. proteamaculans Lgt may differ based on structural variations.

Understanding these species-specific differences is crucial for developing targeted therapeutics that exploit unique features of S. proteamaculans Lgt while minimizing effects on beneficial bacteria or host processes.

What are common challenges in recombinant expression of S. proteamaculans Lgt and how can they be addressed?

Recombinant expression of membrane proteins like S. proteamaculans Lgt presents several challenges that researchers should anticipate and address:

  • Protein Misfolding and Inclusion Body Formation

    • Challenge: Overexpression often leads to protein aggregation and inclusion body formation.

    • Solution:

      • Lower the expression temperature (16-20°C)

      • Use specialized E. coli strains (C41, C43) designed for membrane protein expression

      • Optimize induction conditions (lower IPTG concentration, 0.1-0.5 mM)

      • Consider fusion partners that enhance solubility (MBP, SUMO)

      • GST-fusion has been successfully used for Lgt expression

  • Low Expression Levels

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution:

      • Optimize codon usage for E. coli

      • Use strong promoters balanced with appropriate induction conditions

      • Screen multiple constructs with different N- or C-terminal truncations

      • Consider expression in specialized lipid environments

  • Protein Toxicity to Host Cells

    • Challenge: Expression of foreign membrane proteins can be toxic to host cells.

    • Solution:

      • Use tightly regulated expression systems

      • Balance protein expression with cell growth

      • Consider using cell-free expression systems

  • Inefficient Membrane Insertion

    • Challenge: Proper insertion into the membrane is critical for functional Lgt.

    • Solution:

      • Co-express with chaperones that assist membrane protein folding

      • Use E. coli strains with enhanced membrane protein insertion machinery

      • Consider using bacterial strains closer to S. proteamaculans for expression

  • Protein Instability During Purification

    • Challenge: Membrane proteins often lose activity during solubilization and purification.

    • Solution:

      • Screen multiple detergents for optimal extraction (DDM, LDAO, OG)

      • Include stabilizers in purification buffers (glycerol, specific lipids)

      • Consider nanodiscs or amphipols for maintaining native-like environment

      • Minimize purification steps and time

  • Activity Assessment

    • Challenge: Confirming that purified Lgt is properly folded and active.

    • Solution:

      • Develop robust activity assays based on glycerol phosphate release

      • Include known substrates (e.g., Pal-IAAC peptide)

      • Compare activity to well-characterized Lgt from other species (E. coli)

Implementing these strategies should help overcome the common challenges associated with recombinant expression of S. proteamaculans Lgt and yield functional protein for further studies.

How can researchers reconcile conflicting data on Lgt function in different experimental systems?

Reconciling conflicting data on Lgt function across different experimental systems requires a systematic approach to identify sources of variation and establish consensus findings:

  • Methodological Standardization and Assessment

    • Compare Experimental Protocols: Create detailed comparison tables of methods used in conflicting studies, noting differences in:

      • Expression systems and constructs

      • Purification methods

      • Assay conditions (buffers, temperatures, substrates)

      • Detection methods

    • Replicate Key Experiments: Reproduce pivotal experiments from conflicting studies under identical conditions to determine if methodology is the source of discrepancy .

  • Biological Variables Analysis

    • Strain Differences: Consider if S. proteamaculans strain variations might explain functional differences:

      • Compare genomic sequences of strains used

      • Analyze Lgt protein sequences for polymorphisms

      • Evaluate background mutations that might affect Lgt function

    • Growth Conditions: Assess whether differences in bacterial growth conditions affect Lgt function:

      • Growth phase effects (particularly important given QS regulation)

      • Media composition (especially iron availability)

      • Temperature and other environmental factors

  • Integrated Data Analysis Approaches

    • Meta-analysis: Perform quantitative meta-analysis of available data using appropriate statistical methods.

    • Bayesian Analysis: Use Bayesian approaches to incorporate prior knowledge and update probability estimates based on new evidence.

    • Statistical Consultation: Engage with statisticians to ensure proper experimental design and analysis .

  • Reconciliation Strategies

    • Conditional Models: Develop models that explain when and why Lgt function differs under various conditions.

    • Mechanistic Investigation: Design experiments specifically to test hypotheses about why conflicting results occur.

    • Collaborative Cross-validation: Establish collaborations between labs with conflicting results to perform identical experiments with shared materials.

  • Contextual Interpretation Framework

    Data Conflict TypePotential ExplanationsResolution Approach
    Activity level differencesAssay sensitivity, protein qualityDirect comparison using standardized assay
    Substrate specificity variationsExpression system effects on lipid compositionTest multiple substrate types in controlled system
    Regulatory differencesStrain-specific regulation, environmental factorsCompare gene expression profiles under identical conditions
    Inhibitor efficacy discrepanciesProtein structural differences, assay conditionsStructure-activity relationship studies, binding assays
    Virulence contribution inconsistenciesHost cell types, infection modelsStandardized infection models with multiple readouts

By systematically addressing these aspects, researchers can develop a more nuanced understanding of Lgt function that accounts for experimental and biological variables, ultimately resolving apparent conflicts in the literature.

What statistical approaches are most appropriate for analyzing Lgt inhibition data in antimicrobial development studies?

Table 2: Statistical Approaches for Different Types of Lgt Inhibition Data

Data TypeRecommended Statistical ApproachKey ConsiderationsSoftware Options
Enzyme inhibition assaysNonlinear regression (4PL model)Include appropriate controls, minimum 5-7 concentrationsGraphPad Prism, R (drc package)
Bacterial growth inhibitionTime-integrated metrics (e.g., AUC)Account for growth rate variations, test across multiple strainsR (growthcurver), GraphPad Prism
Multiple inhibitor comparisonANOVA with Tukey's or Dunnett's testEnsure homogeneity of variance, consider logarithmic transformationSPSS, R (multcomp package)
Resistance frequencyFluctuation analysisUse appropriate distribution (Luria-Delbrück), adequate replicationFALCOR, R (rSalvador)
Cytotoxicity assessmentIC₅₀ ratio (therapeutic index)Calculate confidence intervals for selectivity indexGraphPad Prism, R

By applying these statistical approaches, researchers can ensure robust analysis of Lgt inhibition data, facilitating the development of effective antimicrobial compounds targeting this essential enzyme .

What are the most promising approaches for developing selective inhibitors of S. proteamaculans Lgt?

Developing selective inhibitors of S. proteamaculans Lgt requires targeting unique features of this enzyme while minimizing effects on host enzymes or beneficial microbiota. Several promising approaches warrant investigation:

  • Structure-Based Drug Design

    • Resolve the crystal structure of S. proteamaculans Lgt to identify unique binding pockets

    • Compare with E. coli Lgt structure to identify species-specific differences

    • Use computational methods (molecular docking, molecular dynamics) to design inhibitors that preferentially bind S. proteamaculans Lgt

    • Focus on compounds that interact with critical residues equivalent to Arg143 and Arg239 in E. coli Lgt

  • Substrate Analog Development

    • Design peptide mimetics based on S. proteamaculans lipoprotein signal sequences

    • Develop phospholipid analogs that compete with phosphatidylglycerol binding

    • Create transition state analogs that inhibit the diacylglyceryl transfer reaction

    • Synthesize bi-substrate inhibitors that bridge both binding sites identified in E. coli Lgt

  • High-Throughput Screening Approaches

    • Develop a robust glycerol phosphate detection assay for S. proteamaculans Lgt

    • Screen diverse chemical libraries, including natural product extracts

    • Use fragment-based screening to identify novel chemical scaffolds

    • Screen the compounds G9066, G2823, and G2824 that inhibit E. coli Lgt against S. proteamaculans Lgt

  • Targeting Regulatory Mechanisms

    • Exploit the quorum sensing regulatory pathway that influences S. proteamaculans virulence

    • Develop compounds that enhance Lgt regulation by the SprI/SprR system

    • Target iron-dependent regulatory mechanisms that affect S. proteamaculans virulence

  • Combination Approaches

    • Design dual-action inhibitors that target both Lgt and other virulence factors (e.g., protealysin, hemolysin ShlA, serralysin)

    • Develop combinations of Lgt inhibitors with conventional antibiotics to exploit the membrane permeabilization effect

    • Create prodrugs that are activated by S. proteamaculans-specific enzymes to achieve selectivity

Table 3: Potential Scaffolds for S. proteamaculans Lgt Inhibitor Development

Chemical ScaffoldRationalePotential AdvantagesDevelopment Challenges
Phospholipid analogsMimic natural substrateDirect competition with natural substrateMembrane permeability, specificity
Peptide mimeticsTarget lipobox recognitionHigh specificity potentialPharmacokinetic limitations
Small molecule enzyme inhibitors (like G9066, G2823, G2824) Known efficacy against related LgtEstablished proof-of-conceptSpecificity to S. proteamaculans
Natural product derivativesNovel chemical spacePotential for unique mechanismsStructure elucidation, synthesis
Covalent inhibitorsIrreversible inactivationProlonged effectSelectivity concerns, toxicity

Each of these approaches offers distinct advantages, and a multi-pronged strategy combining structural insights, biochemical understanding, and innovative screening methods is likely to yield the most promising selective inhibitors of S. proteamaculans Lgt.

How might genetic manipulation of Lgt pathways be used to attenuate S. proteamaculans virulence for vaccine development?

Genetic manipulation of Lgt pathways offers promising avenues for developing attenuated S. proteamaculans strains that could serve as live attenuated vaccine candidates. Several strategic approaches merit consideration:

  • Conditional Lgt Expression Systems

    • Approach: Engineer strains with Lgt expression under control of inducible promoters

    • Mechanism: Allows controlled attenuation by modulating Lgt levels

    • Advantage: Enables balanced attenuation that maintains immunogenicity while reducing virulence

    • Challenges: Ensuring stable regulation in vivo and preventing reversion

  • Site-Directed Mutagenesis of Lgt

    • Approach: Introduce specific mutations in the lgt gene to reduce but not eliminate enzyme activity

    • Target Sites: Focus on residues equivalent to the critical Arg143 and Arg239 identified in E. coli Lgt

    • Advantage: Creates strains with predictable levels of attenuation

    • Challenges: Identifying mutations that provide appropriate attenuation without complete loss of viability

  • Manipulation of Lgt Regulatory Networks

    • Approach: Modify the quorum sensing regulatory system (SprI/SprR) that influences virulence factor expression

    • Mechanism: Since SprI inactivation increases invasive activity , carefully calibrated modifications could achieve optimal attenuation

    • Advantage: Leverages natural regulatory systems to control virulence

    • Challenges: Complex regulatory networks may have unpredictable effects

  • Complementation-Based Attenuation

    • Approach: Create Lgt-deficient strains complemented with partially functional Lgt variants

    • Design: Express modified Lgt proteins with reduced catalytic efficiency

    • Advantage: Allows fine-tuning of attenuation level

    • Challenges: Ensuring stability of the complementation system in vivo

  • Combination with Other Virulence Factor Modifications

    • Approach: Pair Lgt pathway modifications with alterations in other virulence factors

    • Targets: Combine with modifications to protealysin, hemolysin ShlA, or serralysin genes

    • Advantage: Multi-factorial attenuation reduces risk of reversion to virulence

    • Challenges: Balancing multiple modifications to maintain immunogenicity

Table 4: Potential Genetic Attenuation Strategies and Their Characteristics

Attenuation StrategyGenetic ModificationExpected Effect on VirulenceImmunogenic PotentialSafety Considerations
Lgt activity reductionPoint mutations in catalytic residuesModerate reduction in virulenceHigh if lipoprotein presentation maintainedPotential for reversion
Conditional Lgt expressionInducible promoter controlling lgtTunable virulence attenuationCan be optimized by expression levelPromoter stability in vivo
Quorum sensing modificationSprR overexpressionReduced invasion capabilityMaintains antigen productionComplex regulatory effects
Iron-responsive attenuationModify iron-dependent regulationContext-dependent attenuationMimics in vivo conditionsEnvironmental sensitivity
Multi-target approachCombined lgt and protease modificationsSubstantial virulence reductionModified antigen presentationLowest reversion risk

The development of such attenuated strains would require rigorous testing for stability, immunogenicity, and safety. The ideal vaccine strain would maintain sufficient metabolic activity to express protective antigens while displaying significantly reduced virulence. Monitoring lipoprotein processing in these attenuated strains would be essential to ensure they maintain the ability to stimulate protective immunity.

What are the potential applications of recombinant S. proteamaculans Lgt in synthetic biology and biotechnology?

Recombinant S. proteamaculans Lgt offers diverse applications in synthetic biology and biotechnology that extend beyond antimicrobial development. The enzyme's ability to modify proteins with lipid moieties creates opportunities for innovative applications:

  • Protein Display Technologies

    • Bacterial Surface Display: Utilize Lgt to anchor recombinant proteins to bacterial surfaces for whole-cell biocatalysts or vaccine development

    • Liposome and Nanoparticle Functionalization: Employ Lgt to attach proteins to synthetic lipid membranes, creating functionalized drug delivery systems

    • Biosensor Development: Create lipid-anchored receptor proteins with improved orientation and sensitivity for detection applications

  • Protein Engineering and Modification

    • Enhanced Protein Stability: Add lipid anchors to recombinant proteins to improve their stability and half-life

    • Membrane Protein Solubilization: Use Lgt-mediated lipidation to facilitate the handling and structural studies of challenging membrane proteins

    • Directed Evolution Platform: Develop systems for evolving Lgt variants with novel substrate specificities or activities

  • Diagnostic Applications

    • Enzyme-Linked Immunosorbent Assays (ELISAs): Create lipid-modified antibodies or antigens with enhanced surface attachment properties

    • Point-of-Care Diagnostics: Develop stable lipidated proteins for diagnostic devices with extended shelf life

    • Imaging Probes: Design lipidated fluorescent proteins or binding proteins for cell membrane studies

  • Biocatalysis and Industrial Applications

    • Immobilized Enzyme Technology: Use Lgt to anchor enzymes to membranes for continuous bioprocessing

    • Lipid Remodeling: Employ Lgt for the synthesis of novel phospholipids or lipid modifications

    • Detergent-Free Protein Purification: Develop Lgt-based methods for membrane protein isolation that avoid detergent use

  • Fundamental Research Tools

    • Membrane Protein Topology Studies: Utilize Lgt to introduce site-specific lipid anchors for membrane topology mapping

    • Protein-Lipid Interaction Research: Create defined lipidated proteins to study protein-lipid interactions

    • Synthetic Cell Development: Incorporate Lgt in minimal cell systems to enable proper membrane protein localization

Table 5: Potential Biotechnological Applications of Recombinant S. proteamaculans Lgt

Application AreaSpecific Use CaseTechnical ApproachPotential Advantages
Vaccine TechnologyLipid-conjugated antigensExpress antigens with Lgt recognition sequencesEnhanced immune stimulation, improved adjuvant properties
Protein TherapeuticsLipidated cytokines or growth factorsEnzymatic modification of recombinant proteinsExtended half-life, targeted delivery to membranes
Synthetic BiologyArtificial organellesLgt-mediated protein anchoring to synthetic vesiclesControlled localization of enzymes in artificial cells
Structural BiologyMembrane protein crystallizationLipidation-assisted crystallizationBetter crystal packing, maintained native structure
NanotechnologyBio-functionalized nanoparticlesLgt-mediated protein attachment to lipid-coated nanoparticlesOriented protein display, reduced non-specific adsorption

The development of recombinant S. proteamaculans Lgt as a biotechnological tool would require optimization of expression systems, characterization of substrate specificity, and engineering of the enzyme for specific applications. The demonstrated activity of GST-tagged Lgt constructs suggests that fusion proteins could be developed with enhanced stability or specificity for particular biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.