Recombinant Serratia proteamaculans Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Spro_1192; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
crcB
Target Protein Sequence
MLSSLLAVFIGGGMGSVLRWAISMKMNPLNAHIPLGTLAVNLLGGFIIGLAIAIFSRLTH LDPTWKLLITTGFCGGLTTFSTFSLEVVYLLQDGRFMWALANMLLNLAGSLVMTLLAFML VVWINGQ
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal handling and storage conditions for Recombinant CrcB protein?

For optimal stability of recombinant CrcB protein:

  • Store at -20°C for routine storage

  • For extended preservation, maintain at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein integrity

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for this specific protein

How can I verify the expression and activity of recombinant CrcB protein?

To confirm expression and functionality of recombinant CrcB:

For expression verification:

  • SDS-PAGE analysis followed by Coomassie staining or western blotting

  • Mass spectrometry for precise identification and confirmation of sequence integrity

  • Native PAGE to assess oligomeric state, as CrcB likely forms dimers or multimers

For activity assessment:

  • Fluoride transport assays using fluoride-sensitive electrodes or fluorescent probes

  • Liposome reconstitution assays to measure ion flux across membranes

  • Cell-based assays measuring fluoride resistance in bacteria expressing the recombinant protein

  • Binding assays with fluoride analogs

Most bacterial ion channels, including putative fluoride channels like CrcB, require proper membrane incorporation for activity, so assessment in lipid environments is essential.

How does the Quorum Sensing system in S. proteamaculans potentially influence CrcB expression and function?

S. proteamaculans utilizes a LuxI/LuxR type Quorum Sensing (QS) system consisting of AHL synthase SprI and regulatory receptor SprR . While direct evidence linking QS to CrcB expression isn't established, methodological approaches to investigate this relationship include:

  • Gene expression analysis:

    • Create SprI(-) and SprR(-) mutants using homologous recombination with a suicide vector and gentamicin resistance marker, as performed for other S. proteamaculans studies

    • Measure crcB expression using semi-quantitative RT-PCR with gene-specific primers designed using BLAST-primer software

    • Compare expression levels using S12 ribosomal protein gene as constitutive control

  • Protein-DNA interaction studies:

    • Perform chromatin immunoprecipitation (ChIP) to determine if SprR binds to the crcB promoter region

    • Conduct electrophoretic mobility shift assays (EMSA) with purified SprR protein and labeled crcB promoter fragments

  • Functional analysis:

    • Evaluate CrcB-dependent phenotypes (e.g., fluoride resistance) in QS mutants versus wild-type

    • Test complementation of phenotypes with exogenous AHL molecules

The research by Khusainov et al. (2021) demonstrated that QS system inactivation in S. proteamaculans affects multiple physiological processes, including invasive activity through differential regulation of virulence factors like protealysin and serralysin . This suggests QS might similarly regulate membrane proteins like CrcB.

What experimental design would be optimal for studying CrcB protein interactions with other bacterial membrane components?

To investigate CrcB interactions with other membrane components, a comprehensive experimental design should include:

Table 1: Methodological approaches for studying CrcB protein interactions

MethodTechniqueKey ConsiderationsExpected Outcome
Affinity-basedMembrane protein co-immunoprecipitationUse mild detergents (DDM, LMNG); Apply chemical crosslinking before extractionIdentification of stable interaction partners
Proximity-basedIn vivo photo-crosslinkingIncorporate photo-reactive amino acids at specific CrcB positionsCapture of transient interactions
GeneticBacterial two-hybrid systemCreate fusion constructs compatible with membrane proteinsDetection of binary protein interactions
MicroscopyFRET/BiFCEngineer fluorescent protein fusions that maintain CrcB functionalityVisualization of interactions in living cells
StructuralCryo-EM of membrane complexesEstablish purification protocol that preserves native interactionsStructural details of CrcB protein complexes

For a comprehensive study, focus on:

  • Membrane preparation optimization:

    • Adapt methods from studies of other S. proteamaculans membrane proteins like OmpX

    • Use proper detergent selection for membrane protein extraction while maintaining native interactions

  • Controls and validation:

    • Include known membrane protein complexes as positive controls

    • Validate interactions using orthogonal methods

    • Perform reciprocal pull-downs to confirm specificity

  • Functional correlation:

    • Test how disrupting identified interactions affects CrcB-dependent functions

    • Measure physiological outcomes relevant to fluoride transport

This approach accounts for the challenging nature of membrane protein studies while providing multiple lines of evidence for biologically relevant interactions.

How can I investigate potential roles of CrcB in S. proteamaculans invasive activity?

S. proteamaculans demonstrates invasive activity regulated by multiple factors including the Quorum Sensing system . To investigate CrcB's potential role in this process:

  • Generate and validate crcB mutants:

    • Create crcB knockout mutants using homologous recombination methods similar to those used for sprI gene inactivation

    • Confirm mutant genotype by PCR and phenotype by appropriate assays

    • Create complemented strains expressing wild-type crcB

  • Quantitative invasion assays:

    • Compare wild-type, crcB mutant, and complemented strains using established cell invasion protocols

    • Use human cell lines (e.g., M-HeLa) and embryonic mouse fibroblasts (3T3-SV40) as previously employed for S. proteamaculans invasion studies

    • Measure invasion by gentamicin protection assay and confocal microscopy

    • Assess both adhesion and penetration phases separately

  • Analysis of virulence factor expression:

    • Evaluate expression of known virulence factors in crcB mutants:

      • Measure protealysin activity using actin hydrolysis assays

      • Assess serralysin activity through azocasein hydrolysis and gelatin zymography

      • Determine ShlA pore-forming toxin levels and activity

      • Quantify outer membrane protein OmpX expression

  • Ion homeostasis and invasion correlation:

    • Test invasion efficiency under varying fluoride concentrations

    • Investigate how altered ion homeostasis in crcB mutants affects invasive capacity

    • Measure intracellular ion concentrations during invasion process

Based on previous studies showing that invasive activity of S. proteamaculans appears at the stationary growth phase , experiments should include appropriate time-course analyses focusing on this growth stage.

What approaches can be used to study CrcB's role in fluoride ion channel functionality and bacterial resistance?

To investigate CrcB's function as a fluoride ion channel and its contribution to bacterial resistance:

  • Electrophysiological characterization:

    • Reconstitute purified CrcB into lipid bilayers

    • Perform patch-clamp recordings to measure ion conductance

    • Characterize channel properties (selectivity, gating, kinetics)

    • Compare with known fluoride channels from other bacteria

  • Fluoride tolerance assays:

    • Compare growth curves of wild-type, crcB knockout, and overexpression strains in media containing increasing fluoride concentrations

    • Determine minimum inhibitory concentrations (MICs) for fluoride

    • Assess growth recovery after fluoride challenge

  • Fluoride accumulation measurements:

    • Use fluoride-selective electrodes to measure intracellular fluoride concentrations

    • Track fluoride efflux rates in preloaded cells

    • Compare accumulation patterns between wild-type and mutant strains

  • Cross-resistance profiling:

    • Test sensitivity of crcB mutants to various antibiotics and stress conditions

    • Assess whether fluoride channel function confers resistance to other toxic compounds

    • Evaluate membrane integrity under stress conditions using permeability assays

  • Integration with other resistance mechanisms:

    • Investigate potential interplay between CrcB and other resistance determinants in S. proteamaculans

    • Create double mutants affecting both CrcB and other resistance pathways

    • Assess epistatic relationships through phenotypic analysis

This integrated approach would provide comprehensive insights into CrcB's role in fluoride homeostasis and its contribution to broader bacterial resistance mechanisms.

How can I design experiments to investigate CrcB expression under different environmental conditions relevant to S. proteamaculans ecology?

To analyze CrcB expression under different environmental conditions:

  • Transcriptional analysis:

    • Develop quantitative RT-PCR assays for crcB using the methodology described for S. proteamaculans gene expression studies :

      • Design gene-specific primers using BLAST-primer software

      • Optimize PCR conditions: primary melting at 94°C for 3 min, 30 amplification cycles (94°C for 1 min, annealing at 62°C for 1 min, 72°C for 1 min), final elongation at 72°C for 10 min

      • Use S12 ribosomal protein gene as reference for normalization

    • Test conditions relevant to S. proteamaculans ecology:

      • Iron-limited conditions using 0.3 mM 2,2′-bipyridyl as previously described

      • Different growth phases (logarithmic vs. stationary)

      • Varying temperatures relevant to environmental persistence

  • Reporter systems:

    • Create transcriptional and translational fusions (crcB-lacZ, crcB-GFP)

    • Measure reporter activity under different conditions

    • Correlate with mRNA levels to assess post-transcriptional regulation

  • Environmental condition matrix:

Table 2: Experimental conditions for CrcB expression analysis

ConditionVariablesRationaleAnalysis Methods
Growth phaseLogarithmic vs. stationaryS. proteamaculans invasion factors show growth phase-dependent expression qRT-PCR, reporter activity
Iron availabilityIron-replete vs. iron-limited (0.3 mM 2,2′-bipyridyl)Iron limitation affects invasion and virulence factor expression in S. proteamaculans qRT-PCR, protein expression
Temperature22°C, 30°C, 37°CDifferent temperatures represent environmental vs. host conditionsGrowth curves, expression analysis
Carbon sourceVarious carbon sources including ligninS. proteamaculans shows metabolic versatility, including lignin degradation Metabolic profiling, expression analysis
QS signaling± AHL molecules; wild-type vs. SprI/SprR mutantsQS regulates multiple functions in S. proteamaculans Comparative expression analysis
  • Proteomic verification:

    • Develop antibodies against CrcB or use epitope-tagged constructs

    • Perform western blot analysis to confirm protein expression levels

    • Use membrane fractionation to assess membrane incorporation efficiency

This comprehensive approach examines CrcB expression across conditions relevant to S. proteamaculans ecology and pathogenesis, potentially revealing regulatory mechanisms and environmental triggers.

What are the considerations for experimental design when studying CrcB in the context of S. proteamaculans chitinolytic activity?

S. proteamaculans 568 possesses a well-characterized chitinolytic system including family 33 chitin binding proteins (CBPs) that act synergistically with chitinases . When designing experiments to investigate potential relationships between CrcB and chitinolytic activity:

  • Experimental design principles:

    • Apply randomized block design as recommended for ecological studies with few treatment replicates

    • Include proper controls to account for temporal changes and procedure effects

    • Use interspersion of treatments to minimize spatial segregation effects

  • Specific experimental approaches:

    • Assess chitinolytic activity in crcB mutants vs. wild-type using established assays:

      • Measure degradation of α- and β-chitin substrates

      • Quantify synergistic effects with purified chitinases (SpChiA, SpChiB, SpChiC, SpChiD)

      • Test activity in the presence of electron donors like reduced glutathione

    • Evaluate crcB expression during growth on chitin as sole carbon source

    • Investigate potential co-regulation of crcB with chitin utilization genes

  • Data analysis considerations:

    • Include statistical procedures to account for variability sources :

      • Randomization to reduce experimenter bias

      • Replication to address inherent variability

      • Design control to minimize confusion from temporal changes

While direct evidence for CrcB involvement in chitinolytic activity is not established in the literature, investigating potential connections could reveal novel aspects of S. proteamaculans physiology, particularly regarding membrane transport during chitin metabolism.

How can modern genomic and transcriptomic approaches be applied to study CrcB in the context of S. proteamaculans pathogenesis?

To apply genomic and transcriptomic approaches to CrcB study:

  • Comparative genomics:

    • Analyze crcB gene conservation across Serratia species with different pathogenic potentials

    • Compare with related species like S. marcescens that shows carbapenem resistance

    • Identify genetic linkages between crcB and other pathogenesis-related genes

    • Study synteny of crcB genomic regions across species

  • Transcriptomic analysis:

    • Perform RNA-seq under infection-relevant conditions, following methodologies used in recent Serratia studies :

      • Compare wild-type vs. crcB mutants

      • Analyze expression during different phases of host cell interaction

      • Examine co-expression networks to identify functionally related genes

    • Validate key findings using qRT-PCR as described for other S. proteamaculans genes

  • Integration with proteomic data:

    • Correlate transcriptomic changes with membrane proteome alterations

    • Map protein-protein interaction networks involving CrcB

    • Identify post-transcriptional regulatory mechanisms

  • Functional validation:

    • Test predictions from omics analyses through targeted gene deletions

    • Assess virulence phenotypes in appropriate model systems

    • Use complementation studies to confirm genotype-phenotype relationships

Recent studies with carbapenem-resistant Serratia strains demonstrated the value of whole genome sequencing for understanding resistance mechanisms . Similar approaches could reveal CrcB's role in S. proteamaculans pathogenesis and identify novel therapeutic targets.

What are common challenges in CrcB protein purification and how can they be addressed?

Membrane proteins like CrcB present specific purification challenges:

Table 3: Challenges and solutions for CrcB protein purification

ChallengeCausesSolutions
Low expression yieldToxicity to host, poor membrane integrationUse tightly regulated expression systems; Try different E. coli strains (C41/C43); Consider alternative hosts
Protein aggregationHydrophobic regions, misfoldingOptimize detergent selection; Include stabilizing agents (glycerol, specific lipids); Try fusion tags that enhance solubility
Loss of activityDetergent effects, cofactor lossScreen detergent panel; Supplement with potential cofactors; Reconstitute into nanodiscs or liposomes
Purification interferenceEndogenous proteins binding to resinsOptimize wash conditions; Use tandem purification approaches; Consider on-column refolding
Protein heterogeneityPost-translational modifications, degradationAdd protease inhibitors; Perform limited proteolysis analysis; Use size exclusion chromatography

For optimized CrcB purification:

  • Start with well-established protocols for membrane protein purification

  • Benchmark against recombinant CrcB products available commercially

  • Validate purified protein through functional assays specific to ion channel activity

  • Assess protein quality using biophysical techniques like circular dichroism and thermal shift assays

How can I address data inconsistencies when comparing CrcB functions across different experimental systems?

When encountering data inconsistencies in CrcB research:

  • Systematic analysis of variables:

    • Implement a comprehensive experimental design approach as outlined in Krebs (2017) :

      • Consider treatment structure: Define the set of treatments selected for comparison

      • Define design structure: Specify rules for treatment allocation to experimental units

      • Establish response structure: Detail measurements to be made on each experimental unit

    • Document and control for sources of variability as listed in Table 10.1 of Krebs (2017) :

      • Temporal change

      • Procedure effects

      • Experimenter bias

      • Experimenter-generated variability

      • Initial/inherent variability among experimental units

      • Nondemonic intrusion (chance events)

  • Statistical approaches:

    • Apply appropriate statistical designs based on experiment type:

      • Completely randomized design for simple experiments

      • Randomized block design for experiments with potential spatial/temporal variability

      • Factorial designs for multiple variables

    • Use proper controls including before-after and control-impact designs

    • Implement interspersion of treatments to minimize spatial effects

  • Reconciliation strategies:

    • Conduct meta-analysis of multiple experiments

    • Perform systematic replication with carefully controlled variables

    • Develop mechanistic models to explain apparent contradictions

By applying these methodological approaches, researchers can address inconsistencies and develop a more robust understanding of CrcB function across experimental systems.

What emerging technologies hold promise for advancing CrcB research in S. proteamaculans?

Several cutting-edge technologies offer significant potential for advancing CrcB research:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural determination of membrane-embedded CrcB

    • Visualization of conformational changes during ion transport

    • Elucidation of interactions with other membrane components

  • CRISPR-Cas9 genome editing:

    • Precise genetic manipulation of crcB and related genes

    • Creation of conditional knockouts for essential genes

    • Introduction of specific mutations to test structure-function hypotheses

    • Implementation of CRISPRi for tunable gene expression control

  • Single-cell technologies:

    • Analysis of cell-to-cell variability in CrcB expression and function

    • Correlation of CrcB activity with individual cell phenotypes

    • Tracking of cellular responses to environmental changes at single-cell resolution

  • Microfluidic systems:

    • Real-time monitoring of ion flux in individual cells

    • Creation of controlled chemical gradients to test CrcB response

    • High-throughput screening of conditions affecting CrcB function

  • Synthetic biology approaches:

    • Engineering of modified CrcB proteins with enhanced or altered functions

    • Creation of minimal systems for studying CrcB in isolation

    • Development of biosensors based on CrcB function

  • Computational biology:

    • Molecular dynamics simulations of ion transport

    • Machine learning approaches to predict regulatory networks

    • Systems biology integration of multi-omics data

These technologies, applied to S. proteamaculans CrcB research, could reveal fundamental insights into membrane protein function and identify novel applications in biotechnology and medicine.

How might CrcB research contribute to broader understanding of bacterial adaptation mechanisms?

CrcB research in S. proteamaculans has potential to advance understanding of bacterial adaptation through:

  • Ion homeostasis mechanisms:

    • Elucidation of how bacteria maintain ion balance under environmental stress

    • Understanding the role of selective ion channels in adaptation to toxic compounds

    • Insights into evolutionary conservation of ion transport systems

  • Environmental adaptation:

    • Investigation of how S. proteamaculans adapts to fluoride-rich environments

    • Understanding of membrane adaptations during host-microbe interactions

    • Insight into bacterial responses to anthropogenic pollutants

  • Antimicrobial resistance:

    • Potential connections between ion homeostasis and antibiotic resistance

    • Comparison with carbapenem resistance mechanisms in related Serratia species

    • Identification of novel targets for antimicrobial development

  • Ecological interactions:

    • Role of CrcB in S. proteamaculans interactions with environmental chitin

    • Connections to quorum sensing systems that regulate collective behaviors

    • Contribution to bacterial competitive fitness in complex communities

  • Evolutionary biology:

    • Analysis of selective pressures driving crcB conservation

    • Understanding of horizontal gene transfer patterns for membrane transport systems

    • Insights into co-evolution of transport systems with environmental niches

By connecting CrcB research to these broader biological questions, investigators can contribute not only to understanding of a specific protein but also to fundamental principles of bacterial adaptation that may inform biotechnology and medical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.