Recombinant Serratia proteamaculans Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
mdtI; Spro_2765; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
mdtI
Target Protein Sequence
MQQLELYHIAFLGLAIVLEIIANIFLKMSDGFRKVWLGLLSLLSVLGAFSALAQAVKGID LSVAYALWGGFGIAATIAAGWILFGQRLNAKGWIGLVLLLAGMVIIKLA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant MdtI protein typically produced for research purposes?

The recombinant production of MdtI protein typically involves expression in E. coli host systems using the following methodological approach:

  • Gene synthesis or cloning of the mdtI gene sequence from Serratia proteamaculans

  • Insertion into an expression vector with an appropriate tag (most commonly His-tag at the N-terminus)

  • Transformation into competent E. coli cells

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification using affinity chromatography

  • Concentration and lyophilization for long-term storage

The resulting purified protein typically achieves >90% purity as determined by SDS-PAGE analysis . The recombinant protein's integrity can be verified through mass spectrometry and western blotting techniques to confirm both size and immunoreactivity.

What are the optimal storage and handling conditions for recombinant MdtI?

For optimal stability and activity retention, recombinant MdtI protein should be handled according to these research-validated protocols:

  • Storage temperature: -20°C to -80°C for long-term preservation

  • Buffer composition: Tris/PBS-based buffer at pH 8.0 with 6% trehalose or 50% glycerol as cryoprotectants

  • Reconstitution: With deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles

  • Working storage: Maintain working aliquots at 4°C for up to one week

  • Quality control: Verify protein stability through periodic activity assays

Researchers should note that repeated freeze-thaw cycles significantly reduce protein functionality and should be avoided . The addition of glycerol (5-50% final concentration) is recommended for reconstituted protein solutions intended for long-term storage.

What is known about the structure-function relationship of MdtI in Serratia proteamaculans?

The structure-function relationship of MdtI reveals important insights into its biological role:

MdtI is a small membrane protein with predominantly hydrophobic regions arranged in transmembrane helices. Structural analysis suggests that MdtI contains multiple transmembrane domains characteristic of transport proteins, with hydrophobic amino acid clusters forming the channel through which spermidine is exported .

Key structural elements include:

  • N-terminal region: Contains signaling sequences for membrane insertion

  • Transmembrane domains: Form a pore through which substrates are transported

  • Hydrophilic loops: May interact with cytoplasmic regulatory proteins

Functionally, MdtI operates as part of bacterial defense mechanisms by exporting spermidine and potentially other compounds that might be toxic to the cell. This export mechanism contributes to bacterial survival under adverse conditions, including exposure to antimicrobial agents.

The amino acid sequence suggests structural similarities to other multidrug resistance proteins, particularly those involved in small molecule transport across bacterial membranes. Comparative analysis with related proteins in other Enterobacteriaceae reveals conserved domains likely essential for transport functionality.

How does MdtI contribute to antimicrobial resistance mechanisms in bacteria?

MdtI contributes to antimicrobial resistance through several mechanisms:

  • Efflux pump activity: MdtI functions as part of bacterial efflux systems that actively export antimicrobial compounds from the cell, reducing their intracellular concentration below effective levels. This mechanism is particularly relevant for cationic antimicrobials that may interact with polyamines like spermidine.

  • Cross-resistance patterns: Evidence from related multidrug resistance proteins in Enterobacteriaceae suggests that MdtI may contribute to resistance against multiple classes of antimicrobials. Similar proteins in S. marcescens have been associated with tetracycline resistance through efflux mechanisms .

  • Genomic context and regulation: The mdtI gene appears to be part of the accessory genome in Serratia species, which includes genes variably present between isolates . This genomic plasticity contributes to the ability of bacteria to adapt to antimicrobial challenges.

  • Horizontal gene transfer potential: Like other drug resistance determinants in Enterobacteriaceae, mdtI may be subject to horizontal gene transfer, potentially through plasmids, though the current evidence suggests chromosomal encoding .

How does MdtI compare with other multidrug resistance proteins found in Serratia species?

Comparative analysis of MdtI with other multidrug resistance proteins in Serratia species reveals important distinctions and similarities:

ProteinSize (aa)Primary FunctionResistance ProfileGenetic ContextSpecies Distribution
MdtI109Spermidine exportSmall cationic compoundsChromosomalS. proteamaculans
MdtD~400Putative multidrug resistanceBroader spectrumChromosomalS. proteamaculans
TetA5~400Tetracycline effluxTetracyclines, minocyclineChromosomal insertionS. marcescens
TetA3~380Tetracycline effluxTetracyclinesPlasmid (pIGT15)S. marcescens

MdtI is notably smaller than many other multidrug resistance proteins, suggesting a specialized function in polyamine transport rather than the broader substrate profiles typical of larger efflux pumps. Unlike some resistance determinants in S. marcescens that are carried on plasmids like pSMC1 and pSMC2 , current evidence suggests MdtI is chromosomally encoded in S. proteamaculans.

The genomic analysis of Serratia species reveals that resistance genes can be part of the accessory genome (variably present between isolates) rather than the core genome, highlighting the dynamic nature of resistance acquisition and evolution in these bacteria .

What are the recommended approaches for studying MdtI function in laboratory settings?

To effectively study MdtI function, researchers should consider these methodological approaches:

  • Expression systems and functional characterization:

    • Heterologous expression in E. coli lacking endogenous polyamine transporters

    • Transport assays using radiolabeled or fluorescently-tagged spermidine

    • Membrane vesicle preparation for in vitro transport studies

    • Electrophysiological measurements (patch clamp) for direct transport assessment

  • Mutational analysis:

    • Site-directed mutagenesis of conserved residues

    • Creation of deletion mutants in Serratia proteamaculans

    • Complementation studies to confirm phenotype restoration

    • Chimeric protein construction with other MDT family members

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays to identify interaction partners

    • Co-immunoprecipitation with tagged MdtI

    • Crosslinking studies to capture transient interactions

    • Native PAGE analysis for complex formation

  • In vivo resistance assays:

    • Minimum inhibitory concentration (MIC) determination with/without MdtI expression

    • Competition assays between wild-type and mdtI-deficient strains

    • Biofilm formation assays under antimicrobial pressure

    • Time-kill kinetics to assess survival under antimicrobial challenge

Each methodological approach should include appropriate controls, including the use of known inhibitors of polyamine transport and comparison with well-characterized multidrug transporters.

Which advanced techniques are most suitable for analyzing MdtI structure and dynamics?

Advanced structural and dynamic analysis of MdtI requires sophisticated techniques:

  • High-resolution structural analysis:

    • X-ray crystallography (challenging for membrane proteins, may require lipidic cubic phase techniques)

    • Cryo-electron microscopy for protein in native-like lipid environments

    • Nuclear magnetic resonance (NMR) spectroscopy for dynamics studies

    • Small-angle X-ray scattering (SAXS) for envelope structure determination

  • Molecular dynamics simulations:

    • AI2BMD (AI-based ab initio biomolecular dynamics) simulation at ab initio accuracy

    • Classical molecular dynamics in explicit membrane environments

    • Coarse-grained simulations for longer timescale events

    • Quantum mechanics/molecular mechanics (QM/MM) hybrid approaches for substrate interactions

  • Spectroscopic methods:

    • Fluorescence resonance energy transfer (FRET) for conformational changes

    • Circular dichroism (CD) for secondary structure analysis

    • Hydrogen-deuterium exchange mass spectrometry for solvent accessibility

    • Electron paramagnetic resonance (EPR) with site-directed spin labeling

  • Single-molecule techniques:

    • Single-molecule FRET for conformational dynamics

    • Atomic force microscopy for mechanical properties

    • Single-molecule force spectroscopy for unfolding pathways

    • Nanopore analysis for transport events

AI2BMD approaches are particularly promising as they provide ab initio accuracy at computational costs far below traditional quantum mechanics calculations while maintaining significantly higher accuracy than classical simulations . This allows exploration of conformational changes during transport processes that might be inaccessible to experimental techniques.

How can recombinant MdtI be effectively used in antimicrobial resistance research?

Recombinant MdtI can be strategically employed in antimicrobial resistance research through these methodological approaches:

  • Inhibitor discovery and development:

    • High-throughput screening assays using purified MdtI

    • Structure-based virtual screening using computational models

    • Fragment-based drug design targeting MdtI binding sites

    • Validation of hits in whole-cell resistance assays

  • Resistance mechanism elucidation:

    • Overexpression studies to determine contribution to resistance phenotypes

    • Comparative genomics across resistant and susceptible isolates

    • Transcriptional analysis to identify regulatory networks

    • Metabolomic analysis to identify transported substrates beyond spermidine

  • Diagnostic development:

    • Antibody production against recombinant MdtI for immunoassays

    • PCR-based detection of mdtI genes in clinical isolates

    • Mass spectrometry signatures for rapid identification

    • Biosensor development using MdtI-specific aptamers

  • Evolutionary studies:

    • Sequence analysis across Serratia species and related Enterobacteriaceae

    • Reconstruction of ancestral sequences to trace evolutionary history

    • Selection pressure analysis under various antimicrobial exposures

    • Horizontal gene transfer assessments between bacterial populations

Research on S. marcescens has shown that recombination plays only a minor role in shaping diversity within major clades, with rates between 0.01 and 0.07 events per genome per year . Similar evolutionary analyses with mdtI would provide valuable context for understanding resistance emergence and spread.

How might MdtI function be studied in the context of bacterial biofilms and persister cell formation?

Investigating MdtI in biofilm and persister contexts requires specialized approaches:

  • Biofilm-specific expression analysis:

    • Quantitative PCR to assess mdtI expression in biofilm vs. planktonic states

    • Reporter gene fusions (e.g., mdtI-gfp) to visualize expression in live biofilms

    • Single-cell RNA sequencing to identify subpopulations with differential expression

    • Proteomics to quantify MdtI protein levels in biofilm-associated bacteria

  • Functional role in biofilm resistance:

    • Biofilm minimum inhibitory concentration (MBIC) determination with/without MdtI

    • Comparison of wild-type and mdtI-knockout strains in biofilm formation capacity

    • Confocal microscopy with fluorescent antimicrobials to assess penetration

    • Flow cell models to study biofilm development under continuous antimicrobial exposure

  • Persister cell analysis:

    • Fluctuation tests to determine if MdtI affects persister frequency

    • Time-kill curves with high antimicrobial concentrations

    • Fluorescence-activated cell sorting (FACS) to isolate and characterize persisters

    • Single-cell microfluidics to track persister formation and resuscitation

  • Signaling network integration:

    • Analysis of interactions with stress response systems (stringent response, SOS)

    • Determination of regulation by quorum sensing molecules

    • Connection to polyamine metabolism and stress responses

    • Metabolic flux analysis to determine energy requirements for MdtI function

The role of polyamines in biofilm formation is increasingly recognized, suggesting that MdtI's function in spermidine export may influence biofilm development and stability beyond direct antimicrobial resistance mechanisms.

What potential interactions might exist between MdtI and other cellular processes in Serratia proteamaculans?

Understanding MdtI's integration with other cellular processes reveals potential research directions:

  • Polyamine metabolism networks:

    • Coordination with polyamine biosynthetic enzymes (e.g., spermidine synthase)

    • Regulation by polyamine-sensing riboswitches or regulatory proteins

    • Connection to stress response pathways triggered by polyamine imbalance

    • Integration with membrane potential maintenance systems

  • Cell envelope maintenance:

    • Relationships with lipopolysaccharide biosynthesis pathways

    • Interactions with peptidoglycan remodeling during growth

    • Coordination with other membrane proteins maintaining envelope integrity

    • Role in surface charge modulation affecting antimicrobial peptide resistance

  • Motility and virulence mechanisms:

    • Potential contribution to swimming and swarming motility

    • Connection to virulence factor secretion systems

    • Role in host-cell adhesion and invasion processes

    • Contribution to stress survival during host colonization

  • Metabolic adaptation:

    • Response to nutrient limitation and metabolic stress

    • Integration with central carbon metabolism regulation

    • Connection to stringent response during nutrient downshift

    • Role in pH homeostasis maintenance

Research in related Enterobacteriaceae suggests that multidrug resistance proteins like MdtI may have physiological roles beyond antimicrobial resistance, functioning as part of the cell's normal homeostatic mechanisms that can be repurposed for resistance when needed.

How might computational approaches enhance our understanding of MdtI transport mechanisms?

Advanced computational methods offer powerful insights into MdtI function:

  • Machine learning-based substrate prediction:

    • Training models on known substrates of related transporters

    • Identification of molecular features determining substrate specificity

    • Virtual screening of compound libraries to predict novel substrates

    • Integration with experimental validation through transport assays

  • Quantum mechanics approaches for transport energetics:

    • Calculation of energy barriers for substrate binding and translocation

    • Determination of proton coupling mechanisms in transport

    • Analysis of water molecule participation in the transport process

    • Calculation of pKa values for key residues in the transport channel

  • AI-based biomolecular dynamics:

    • AI2BMD simulations to capture conformational changes during transport

    • Exploration of protein-lipid interactions affecting transporter function

    • Identification of allosteric communication pathways within the protein

    • Prediction of effects from point mutations on transport efficiency

  • Systems biology modeling:

    • Integration of MdtI function into whole-cell metabolic models

    • Prediction of fitness effects under various environmental conditions

    • Simulation of evolutionary trajectories under antimicrobial pressure

    • Multi-scale modeling connecting molecular events to population-level outcomes

AI2BMD approaches are particularly valuable as they provide "ab initio accuracy in biomolecular simulations" while remaining computationally tractable for membrane proteins like MdtI . These simulations can explore conformational states that might be inaccessible to traditional MD approaches, potentially revealing novel mechanistic insights into transport function.

What are the implications of MdtI research for understanding evolution of antimicrobial resistance in Enterobacteriaceae?

MdtI research provides evolutionary insights with significant implications:

  • Phylogenetic analysis across bacterial species:

    • Sequence conservation patterns among MdtI homologs in different species

    • Identification of positively selected amino acid residues indicating adaptation

    • Reconstruction of evolutionary history of the mdtI gene

    • Comparison with resistance gene acquisition in clinical isolates

  • Horizontal gene transfer assessment:

    • Analysis of genomic context for evidence of mobile genetic elements

    • Comparison of GC content and codon usage with host genome

    • Phylogenetic incongruence analysis to detect horizontal transfer events

    • Experimental determination of transfer frequencies between bacterial species

  • Resistance co-evolution patterns:

    • Correlation of mdtI presence with other resistance determinants

    • Identification of compensatory mutations maintaining fitness in resistant strains

    • Analysis of epistatic interactions between multiple resistance mechanisms

    • Experimental evolution studies under selective pressure

  • Clinical relevance determination:

    • Screening of clinical isolates for mdtI presence and expression

    • Correlation with treatment failures and persistence of infection

    • Analysis of mdtI variants in successfully spreading resistant clones

    • Potential as a biomarker for predicting resistance development

Analysis of S. marcescens isolates revealed that nosocomial multidrug-resistant infections have been largely driven by a limited number of dominant transmissible clones . Similar research on S. proteamaculans would determine if MdtI plays a comparable role in this species' resistance patterns and clinical significance.

What novel experimental approaches might advance our understanding of MdtI function?

Emerging technologies offer promising avenues for MdtI research:

  • CRISPR-Cas9 genome editing approaches:

    • Precise introduction of point mutations in native genomic context

    • Creation of conditional knockouts to assess essentiality

    • Base editing technology for scanning mutagenesis

    • CRISPRi for titratable repression to study dosage effects

  • Single-molecule imaging in living cells:

    • Super-resolution microscopy to track MdtI localization and clustering

    • Single-particle tracking to analyze membrane diffusion dynamics

    • FRET-based sensors to detect conformational changes during transport

    • Correlative light-electron microscopy for structural context

  • Synthetic biology approaches:

    • Minimal synthetic cells expressing only essential components with MdtI

    • Engineered protein scaffolds to study cooperative transport mechanisms

    • Orthogonal expression systems for precise control of MdtI levels

    • Creation of chimeric transporters to identify functional domains

  • Microfluidic technology applications:

    • Single-cell analysis of MdtI expression heterogeneity

    • Controlled gradient generation for quantitative transport studies

    • Real-time monitoring of cellular responses to antimicrobials

    • Droplet-based high-throughput screening for inhibitor discovery

These approaches would complement existing research and potentially reveal unexpected aspects of MdtI function beyond its characterized role in spermidine export.

How might MdtI structure-function relationships inform novel antimicrobial development strategies?

Structure-function insights can guide antimicrobial development:

  • Structure-based inhibitor design:

    • Identification of critical binding pockets through computational analysis

    • Fragment-based approaches targeting specific functional domains

    • Development of transition-state analogs to block transport mechanism

    • Allosteric inhibitors disrupting conformational changes required for transport

  • Combination therapy approaches:

    • Synergistic inhibitor pairs targeting different aspects of transport function

    • MdtI inhibitors combined with conventional antibiotics to overcome resistance

    • Multi-target strategies addressing multiple resistance mechanisms simultaneously

    • Sequential treatment regimens to prevent resistance development

  • Alternative therapeutic approaches:

    • Aptamer development targeting exposed regions of MdtI

    • Engineered phages expressing MdtI inhibitors

    • Antisense oligonucleotides to reduce mdtI expression

    • CRISPR-Cas delivery systems targeting the mdtI gene

  • Cross-species inhibition potential:

    • Identification of conserved features for broad-spectrum inhibitor development

    • Species-specific targeting for narrow-spectrum approaches

    • Evolutionary constraints predicting resistance development barriers

    • Resistance cost analysis to identify evolutionary disadvantages

Understanding the detailed structure-function relationship would allow for rational design approaches targeting MdtI and related transporters across multiple bacterial pathogens, potentially leading to novel classes of resistance-breaking antimicrobials.

What are the key considerations for designing experiments to study MdtI substrate specificity?

Robust substrate specificity determination requires careful experimental design:

  • Transport assay optimization:

    • Direct measurement approaches:

      • Radiolabeled substrate uptake/efflux assays

      • Fluorescence-based transport measurements

      • LC-MS/MS quantification of substrate concentrations

      • Electrophysiological measurements in reconstituted systems

    • Indirect measurement approaches:

      • Growth-based selection in auxotrophic strains

      • Toxic substrate resistance assays

      • Fluorescent reporter systems linked to substrate sensing

      • Competitive binding assays with known substrates

  • System selection considerations:

    • Purified protein in proteoliposomes: Highest specificity but complex preparation

    • Membrane vesicles: Good compromise between native environment and specificity

    • Intact cells: Most physiologically relevant but potential interference

    • Heterologous expression systems: Reduced background but potential artifacts

  • Critical controls:

    • Transport-deficient mutants (e.g., key residue substitutions)

    • Energy coupling controls (protonophores, ATP depletion)

    • Competitive inhibition with known substrates

    • Membrane integrity verification

  • Data analysis approaches:

    • Kinetic parameter determination (Km, Vmax)

    • Inhibition constant (Ki) calculations

    • Thermodynamic analysis of substrate binding

    • Statistical methods for comparing substrate preferences

Careful attention to these methodological aspects ensures reliable determination of MdtI's substrate profile beyond its characterized spermidine export function.

How can researchers effectively distinguish between direct and indirect effects when studying MdtI's contribution to antimicrobial resistance?

Differentiating direct from indirect effects requires rigorous experimental design:

  • Genetic approach considerations:

    • Clean deletion mutants vs. point mutations in key functional residues

    • Complementation studies with wild-type and mutant variants

    • Inducible expression systems to control timing and level of expression

    • Epistasis analysis with other resistance determinants

  • Biochemical verification:

    • Direct binding assays with purified protein and antimicrobials

    • Transport assays in reconstituted systems lacking other cellular components

    • Competitive inhibition studies with known substrates

    • Site-specific labeling to detect conformational changes upon substrate binding

  • Physiological context analysis:

    • Membrane potential measurements during antimicrobial exposure

    • Intracellular concentration determination of antimicrobials

    • Temporal analysis of resistance development

    • Single-cell studies to assess population heterogeneity

  • Multi-omics integration:

    • Transcriptomic analysis to identify compensatory responses

    • Proteomic studies to detect changes in interaction partners

    • Metabolomic analysis to identify altered metabolic pathways

    • Systems biology modeling to predict network effects

Analysis of S. marcescens has shown that resistance mechanisms often involve multiple factors , emphasizing the importance of distinguishing direct MdtI effects from broader cellular responses when characterizing its role in antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.