Recombinant Serratia proteamaculans Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Serratia proteamaculans Spermidine Export Protein MdtJ (mdtJ)

Recombinant Serratia proteamaculans Spermidine export protein MdtJ (mdtJ) is a protein involved in the export of spermidine, a polyamine essential for cell growth and survival. This protein is part of the small multidrug resistance family and plays a crucial role in maintaining polyamine homeostasis within cells by facilitating the excretion of excess spermidine, which can be toxic at high concentrations.

Characteristics of Recombinant Serratia proteamaculans Spermidine Export Protein MdtJ (mdtJ)

The recombinant MdtJ protein from Serratia proteamaculans is typically expressed in Escherichia coli (E. coli) and is available as a full-length protein with 122 amino acids (1-122aa). It is often fused with an N-terminal His tag to facilitate purification and detection. The protein is provided in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE .

Function and Importance of MdtJ

MdtJ, along with its partner MdtI, forms a complex that is essential for the export of spermidine from cells. This function is critical because excess spermidine can be toxic to cells, inhibiting growth and viability. The MdtJI complex helps maintain polyamine homeostasis by excreting excess spermidine, thereby protecting cells from its toxic effects .

Research Findings

Research on the MdtJI complex in bacteria like E. coli has shown that both MdtJ and MdtI are necessary for effective spermidine export. Studies have identified specific amino acids in MdtJ and MdtI that are crucial for their excretion activity . The expression of these proteins is often upregulated in response to increased spermidine levels, highlighting their role in responding to polyamine stress .

Applications and Potential Uses

While the primary focus of MdtJ has been on its role in bacterial polyamine homeostasis, understanding its function can provide insights into managing polyamine levels in various organisms. This knowledge could be applied in fields such as biotechnology and medicine, where controlling polyamine levels is important for cell health and function.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize development to meet your specifications.
Synonyms
mdtJ; Spro_2766; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
mdtJ
Target Protein Sequence
MIYWIFLGLAIATEIIGTLSMKYASISGGMTGHIVMYVMITASYVMLSMAVKRVALGVAY ALWEGIGILFITLFSVLWFDEPISALKVLGLVTLIVGIMLVKSGTRKPRKQVTPRGDNHA TA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MdtJ protein in Serratia proteamaculans?

MdtJ functions as part of the MdtJI complex, a specialized transporter involved in polyamine exchange across the bacterial membrane. By analogy to related organisms, the MdtJI complex in S. proteamaculans likely serves as an efflux pump that can promote the excretion of putrescine (a spermidine precursor) and potentially other polyamines. In Shigella, this complex acts as a "safety valve" allowing the bacterium to maintain spermidine at optimal levels while preventing toxicity due to over-accumulation . Similar functions are expected in S. proteamaculans, though species-specific adaptations may exist based on its ecological niche.

The experimental approach to confirm this function involves:

  • Gene knockout studies to observe changes in polyamine levels

  • Complementation with recombinant MdtJ to restore function

  • Radioactive polyamine uptake/efflux assays using membrane vesicles

  • Growth studies under varying polyamine concentrations

How is the mdtJ gene organized in the S. proteamaculans genome?

Based on studies in related organisms, the mdtJ gene in S. proteamaculans is likely organized in an operon (mdtJI) encoding both components of the transport complex. In Shigella and E. coli, mdtJ and mdtI are co-transcribed under the control of a single promoter . To confirm this organization in S. proteamaculans:

  • Perform primer extension analysis to identify the transcription start site

  • Use reverse transcription PCR with primers spanning the intergenic region

  • Conduct promoter fusion experiments with reporter genes

  • Analyze RNA-seq data to confirm co-transcription

The mdtJI promoter can be identified using primer extension analysis following RNA purification, similar to the approach used for Shigella . Specific primers can be designed based on the S. proteamaculans genome sequence, similar to the oligos used for Shigella (mJIf/mJIr) .

What expression systems are suitable for recombinant production of S. proteamaculans MdtJ?

For recombinant expression of S. proteamaculans MdtJ, consider the following systems:

Expression SystemAdvantagesLimitationsYieldPurification Tags
E. coli BL21(DE3)High yield, simple protocolsPotential toxicity, inclusion bodies5-10 mg/LHis6, FLAG
E. coli Lemo21(DE3)Tunable expression, membrane protein suitableLower yields2-5 mg/LHis6, Strep-tag
Cell-free systemsAvoids toxicity, rapid expressionExpensive, lower scale0.5-1 mg/mLHis6, Strep-tag
S. proteamaculans hostNative environment, proper foldingLimited tools, lower yields1-3 mg/LFLAG, His6

Methodological approach:

  • Clone the mdtJ gene with appropriate tags using PCR amplification from genomic DNA

  • Optimize codon usage for the chosen expression system

  • Use inducible promoters (IPTG, arabinose) with careful titration

  • Include membrane-targeting sequences for proper localization

  • Extract with mild detergents (DDM, LDAO) for proper solubilization

What basic assays can confirm the functionality of recombinant MdtJ?

To verify that recombinantly expressed MdtJ is functional:

  • Complementation studies in mdtJ knockout strains

  • Growth rescue experiments under polyamine stress conditions

  • Membrane localization using GFP fusion constructs

  • Polyamine transport assays using radiolabeled substrates

  • Binding assays with known substrates

For quantitative assessment of transport activity, radioactive tracer experiments using labeled polyamines (14C-spermidine, 14C-putrescine) can be performed with membrane vesicles containing the recombinant protein. Additionally, conducting growth assays in the presence of various concentrations of polyamines can provide functional evidence, as demonstrated in similar studies with Shigella .

How do growth conditions affect the expression of native MdtJ in S. proteamaculans?

Based on studies in related organisms, multiple factors likely regulate mdtJI expression in S. proteamaculans:

Environmental FactorExpected EffectExperimental ApproachMolecular Mechanism
Polyamine levelsUpregulation with high spermidineqRT-PCR, reporter fusionsPossible feedback regulation
pHEnhanced at alkaline pHGrowth in buffered mediaMay relate to polyamine charge state
TemperatureOptimal at mesophilic range (27-33°C)Controlled culture conditionsSimilar to optimal growth of strain AORB19
Growth phaseIncreased in late exponential phaseTime-course samplingRelated to stress response
Metal ionsEnhancement with Li+, Cu2+, Ca2+, Mn2+Supplemented mediaSimilar to effects seen with S. proteamaculans AORB19

To quantify these effects, real-time qPCR analysis can be performed using primers designed for the mdtJI transcript (similar to the mJIf/mJIr primer set described for Shigella) . Appropriate endogenous controls, such as nusA transcript (using primers similar to nusAF/nusAR), should be included . The ΔCt-values can be analyzed using the 2-ΔΔCt method to determine relative expression levels .

What structural features distinguish MdtJ from other SMR family transporters?

MdtJ belongs to the small multidrug resistance (SMR) family of transporters. Advanced structural analysis reveals:

  • Four transmembrane segments with most functional residues facing the cytoplasm

  • Structural organization similar to other polyamine excretion proteins (PotE, CadB)

  • Likely functions as a dimer with MdtI for full transport activity

To investigate the structure-function relationship:

  • Perform site-directed mutagenesis of conserved residues

  • Use cysteine-scanning mutagenesis to map the transport channel

  • Develop homology models based on solved structures of SMR family members

  • Apply cryo-EM or crystallography for direct structural determination

  • Employ computational simulations to model polyamine transport

How does the recombinant MdtJ from S. proteamaculans interact with the MdtI component?

The MdtJ protein likely forms a functional complex with MdtI. To characterize this interaction:

  • Co-expression and co-purification studies using differentially tagged proteins

  • Biolayer interferometry or surface plasmon resonance to measure binding kinetics

  • Cross-linking mass spectrometry to identify interaction interfaces

  • FRET analysis of labeled components to confirm proximity in membranes

  • Functional complementation with chimeric proteins

Experimental protocol:

  • Co-express His-tagged MdtJ and FLAG-tagged MdtI

  • Perform tandem affinity purification to isolate the complex

  • Analyze complex stability under varying detergent and salt conditions

  • Assess transport activity of the purified complex in reconstituted liposomes

  • Map interaction surfaces through systematic mutation of interface residues

How do transcriptional regulators control mdtJI expression in S. proteamaculans?

Based on studies in Shigella, several factors may regulate mdtJI expression in S. proteamaculans:

RegulatorExpected EffectDetection MethodBinding Site Analysis
H-NSRepressionChIP-seq, gel-retardationPromoter binding
VirF homologsActivationTranscription assaysSimilar to Shigella virF
Polyamine-responsive factorsModulationRNA-seq under varying polyamine levelsPotential spermidine-sensing elements
Growth phase regulatorsTemporal controlTime-course analysisStationary phase elements

To investigate these regulatory mechanisms:

  • Perform chromatin immunoprecipitation (ChIP) to identify bound regulators

  • Conduct gel retardation experiments with purified regulators and the mdtJI promoter region

  • Create promoter deletions to map regulatory elements

  • Use reporter gene fusions to quantify promoter activity under varying conditions

  • Apply transcriptomics approaches to identify co-regulated genes

The H-NS protein, a major nucleoid protein, likely plays a key role in repressing the mdtJI operon by direct binding to the regulatory region, as observed in E. coli .

What methodologies can resolve contradictory data on MdtJ substrate specificity?

When encountering contradictory results regarding MdtJ substrate specificity:

  • Standardize expression systems and purification protocols

    • Use identical purification tags and identical detergents

    • Verify protein integrity by mass spectrometry

  • Apply multiple complementary transport assays

    • Direct transport using radiolabeled substrates

    • Indirect coupling to pH-sensitive fluorophores

    • Competition assays with known substrates

    • Membrane potential measurements

  • Control for experimental variables

    • Membrane composition in reconstitution experiments

    • pH and ionic strength of assay buffers

    • Presence of contaminating transporters

  • Analyze concentration-dependence

    • Full kinetic analysis (Km, Vmax) for each substrate

    • Substrate inhibition studies

    • Analysis under physiological concentration ranges

When contradictory data emerges, it's essential to consider species-specific adaptations. While the MdtJI complex in E. coli excretes spermidine only under conditions of polyamine over-accumulation , S. proteamaculans may have evolved different regulatory mechanisms suited to its ecological niche.

What controls are essential when studying recombinant S. proteamaculans MdtJ?

Essential controls for MdtJ research include:

  • Expression controls

    • Empty vector transformants

    • Inactive mutant variants (site-directed mutagenesis)

    • Alternative membrane protein expression (different transporter family)

  • Purification controls

    • Verification of protein identity by mass spectrometry

    • Circular dichroism to confirm secondary structure

    • Size-exclusion chromatography to assess oligomeric state

  • Functional assays

    • Transport assays with non-substrate analogs

    • Complementation with homologs from related species

    • Membrane integrity controls (calcein leakage)

  • Regulatory studies

    • Promoter constructs with mutated regulatory elements

    • Control promoters not regulated by the factors of interest

    • Housekeeping gene controls for expression studies (e.g., nusA)

How can researchers quantitatively assess polyamine transport mediated by recombinant MdtJ?

For quantitative assessment of MdtJ-mediated transport:

Assay TypeSubstrateDetection MethodAdvantagesLimitations
Radioisotope uptake14C-putrescineScintillation countingDirect measurementRadiation hazard
Fluorescent polyamine analogsFITC-cadaverineFluorescence spectroscopyReal-time kineticsModified substrate
Indirect couplingH+ co-transportpH-sensitive dyesPhysiologicalIndirect measurement
Reconstituted systemsPurified substratesHPLC quantificationDefined componentsComplex preparation
Cell-based assaysNatural polyaminesLC-MS/MSPhysiologicalBackground transport

Recommended protocol:

  • Prepare inside-out membrane vesicles from cells expressing MdtJ

  • Establish baseline with control vesicles (empty vector)

  • Initiate transport with energy source (ATP, membrane potential)

  • Quantify substrate movement over time (multiple time points)

  • Calculate initial rates at varying substrate concentrations

  • Derive kinetic parameters (Km, Vmax) through regression analysis

How should researchers approach heterologous expression of S. proteamaculans MdtJ in different host systems?

When expressing S. proteamaculans MdtJ in heterologous systems:

  • Codon optimization strategies

    • Analyze codon usage bias between S. proteamaculans and the host

    • Optimize rare codons while maintaining critical regions

    • Consider GC content and mRNA secondary structure

  • Expression vector selection

    • Evaluate promoter strength and inducibility

    • Select appropriate fusion tags for detection and purification

    • Consider inclusion of native ribosome binding sites

  • Host strain selection

    • Use strains optimized for membrane protein expression

    • Consider knockout strains lacking endogenous transporters

    • Evaluate compatibility with S. proteamaculans proteins

  • Expression conditions

    • Test induction at varying cell densities

    • Optimize growth temperature (likely 27-33°C based on S. proteamaculans growth)

    • Evaluate metal ion supplementation (Li+, Cu2+, Ca2+, Mn2+)

  • Membrane extraction

    • Test multiple detergents for optimal solubilization

    • Use gentle extraction to maintain protein-protein interactions

    • Verify functional integrity after reconstitution

How can researchers differentiate between direct and indirect effects when studying MdtJ function?

To distinguish direct from indirect effects:

  • Perform complementary in vitro and in vivo assays

    • Purified protein reconstitution experiments

    • Whole-cell transport assays

    • Growth phenotype analysis

  • Use specific inhibitors and competitors

    • Apply known polyamine transport inhibitors

    • Test structural analogs as competitive inhibitors

    • Use metabolic inhibitors to block indirect pathways

  • Construct chimeric proteins

    • Swap domains between related transporters

    • Create fusion proteins with independent functional modules

    • Assess which domains confer specific functionalities

  • Apply omics approaches

    • Transcriptomics to identify affected pathways

    • Metabolomics to measure global polyamine changes

    • Proteomics to detect compensatory responses

What statistical approaches are appropriate for analyzing variable MdtJ expression data?

When analyzing variable MdtJ expression data:

  • Normalization strategies

    • Use multiple reference genes (e.g., nusA)

    • Apply geometric averaging of housekeeping genes

    • Consider global normalization methods for RNA-seq

  • Statistical tests

    • Apply Student's t-test for pairwise comparisons

    • Use ANOVA for multiple condition comparisons

    • Employ non-parametric tests for non-normal distributions

  • Experimental design considerations

    • Include adequate biological replicates (minimum n=3)

    • Account for batch effects through experimental design

    • Use time-course studies to capture expression dynamics

  • Data presentation

    • Report fold changes with confidence intervals

    • Present raw Ct values and ΔCt values

    • Use the 2-ΔΔCt method for relative quantification

How should researchers interpret evolutionary analyses of MdtJ across bacterial species?

When interpreting evolutionary data:

  • Sequence analysis approaches

    • Multiple sequence alignment of MdtJ homologs

    • Phylogenetic tree construction using appropriate models

    • Identification of conserved and variable regions

  • Selection pressure analysis

    • Calculate dN/dS ratios across the protein sequence

    • Identify sites under positive or purifying selection

    • Compare transmembrane vs. cytoplasmic regions

  • Structural consideration

    • Map conservation onto structural models

    • Identify functionally constrained regions

    • Assess co-evolution between MdtJ and MdtI

  • Ecological context

    • Correlate sequence variations with bacterial lifestyles

    • Consider host adaptation in pathogenic species

    • Examine environmental adaptations in non-pathogens

What emerging technologies could advance S. proteamaculans MdtJ research?

Cutting-edge approaches for MdtJ research include:

  • Cryo-EM for structural determination

    • Single-particle analysis of purified MdtJI complex

    • Visualization of substrate binding sites

    • Conformational changes during transport cycle

  • Single-molecule techniques

    • FRET studies to track conformational changes

    • Single-molecule transport assays

    • Force spectroscopy to measure protein stability

  • Computational approaches

    • Molecular dynamics simulations of transport

    • Deep learning for predicting regulatory networks

    • Systems biology modeling of polyamine homeostasis

  • Genome editing technologies

    • CRISPR-Cas9 for precise chromosomal modifications

    • Base editing for targeted mutagenesis

    • Creation of synthetic regulatory circuits

How might MdtJ function differ between laboratory and natural environments for S. proteamaculans?

To understand environmental relevance:

  • Comparative analysis of laboratory vs. environmental isolates

    • Sequence variations in coding and regulatory regions

    • Expression levels under simulated environmental conditions

    • Functional assays with environmentally relevant stressors

  • Ecological considerations

    • Role in plant-associated habitats (S. proteamaculans is often plant-associated)

    • Function during temperature fluctuations (S. proteamaculans grows optimally at 27-33°C)

    • Response to metal ions found in natural habitats (Li+, Cu2+, Ca2+, Mn2+)

  • Experimental approaches

    • Microcosm studies simulating natural environments

    • In situ expression analysis from environmental samples

    • Competition assays between wild-type and mdtJ mutants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.