Recombinant Serratia proteamaculans Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Serratia proteamaculans Sulfoxide reductase heme-binding subunit YedZ (yedZ) is a genetically engineered protein expressed in Escherichia coli. This 199-amino acid polypeptide (UniProt ID: A8GK69) includes an N-terminal His-tag for purification and detection purposes . It belongs to the flavocytochrome family and functions as a critical component of sulfoxide reductase systems, which are involved in redox reactions and sulfur metabolism .

Primary Structure

  • Gene Locus: Spro_4415 in Serratia proteamaculans

  • Amino Acid Sequence: Full-length (1-199 aa), with conserved heme-binding domains

  • Molecular Features:

    • Theoretical molecular weight: ~23 kDa (calculated)

    • Post-translational modifications: None reported in recombinant form

Expression System

ParameterDetails
HostEscherichia coli
TagN-terminal His-tag
Purity≥85% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Functional Role

YedZ serves as the heme-binding subunit of the YedYZ sulfoxide reductase complex, which facilitates electron transfer during methionine sulfoxide reduction . Key functional insights include:

  • Heme Coordination: Binds iron-protoporphyrin IX, critical for redox activity .

  • Substrate Specificity: Likely interacts with methionine sulfoxide or related sulfur-containing substrates, though exact mechanisms remain under investigation .

  • Biological Context: In Serratia proteamaculans, sulfoxide reductases may contribute to oxidative stress resistance and metabolic adaptation .

Experimental Use Cases

  • ELISA and Binding Studies: Utilized for antibody production and protein interaction assays due to high purity and epitope accessibility .

  • Structural Biology: Serves as a template for crystallography or NMR studies to resolve heme-binding motifs .

  • Pathogenicity Research: Indirectly linked to bacterial virulence studies, as Serratia proteamaculans employs redox-active proteins for host invasion .

Comparative Analysis with Homologs

YedZ orthologs exist in diverse bacteria, but Serratia proteamaculans' variant exhibits unique features:

SpeciesGene IDKey Differences
Escherichia coliyedZ (ECK1968)Lacks conserved C-terminal motifs
Yersinia pestisYPDSF_0268Reduced heme-binding stability
Agrobacterium tumefaciensAtu1920Divergent substrate-binding region

Challenges and Future Directions

  • Functional Elucidation: The exact physiological role of YedZ in Serratia proteamaculans requires in vivo knockout studies .

  • Biotechnological Potential: Engineered variants could enhance industrial sulfoxide reduction efficiency .

  • Clinical Relevance: Possible applications in designing inhibitors targeting bacterial redox systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msrQ; Spro_4415; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
msrQ
Target Protein Sequence
MRLTPTHIKGIKVAIYLAAFLPFLWLVLSVDQGWFSADPAKDIQHFTGRMTLKLLLATLM IAPLARYTRQPLLIRCRRLVGLWCFAWGTLHLISYSTLELGLSNIGLLGRELVTRPYLTL GIISWLILLALAATSTLWAMRKLGAKWQTLHNLVYLVAILAPIHYLWSVKTFSPQPFIYA LLAVVLLALRYKKFRNWWR
Uniprot No.

Target Background

Function

YedZ is a component of the MsrPQ system, responsible for repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). It utilizes respiratory chain electrons, thereby protecting these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing various periplasmic proteins from methionine oxidation. MsrQ facilitates electron transfer for reduction to the catalytic subunit MsrP, employing the quinone pool of the respiratory chain.

Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Serratia proteamaculans Sulfoxide reductase heme-binding subunit YedZ?

YedZ, now more commonly referred to as MsrQ, is an integral membrane protein that functions as a heme-binding subunit of the sulfoxide reductase system in Serratia proteamaculans. It belongs to the MsrPQ enzymatic system involved in the repair of oxidized proteins in the bacterial periplasm. The protein contains transmembrane domains and serves as an electron donor for the catalytic subunit MsrP (formerly YedY) . The full-length protein consists of 199 amino acids and plays a crucial role in the bacterial oxidative stress response system .

How is the structure of YedZ characterized at the molecular level?

The YedZ (MsrQ) protein from Serratia proteamaculans contains b-type heme binding sites involving conserved histidine residues. Spectroscopic analysis reveals that MsrQ binds two b-type hemes through these histidine residues, which are conserved between the MsrQ and NOX protein families. The reduced state of these b-type hemes can be identified by characteristic absorption peaks at 426, 530, and 558 nm in UV-visible spectroscopy . The protein is anchored to the membrane with its active site facing the periplasm, allowing it to transfer electrons across the membrane to the soluble MsrP component.

What is the evolutionary relationship between bacterial YedZ and eukaryotic proteins?

YedZ (MsrQ) represents a prokaryotic two-component protein system related to the eukaryotic NADPH oxidase (NOX) family. Research has demonstrated structural and functional similarities between these systems, suggesting an evolutionary relationship. The bacterial Fre flavin reductase, which interacts with MsrQ, is functionally related to the dehydrogenase domain of eukaryotic NOX enzymes . This relationship provides valuable insights into the evolution of redox systems across different kingdoms of life.

What are the optimal conditions for heterologous expression and purification of recombinant YedZ?

For optimal heterologous expression of YedZ, researchers have developed systems using GFP fusion proteins to monitor expression levels and membrane integration. The purification protocol typically involves careful membrane solubilization followed by affinity chromatography. Specifically, an MsrQ-GFP fusion protein approach has been successfully employed for expression optimization and subsequent purification of pure MsrQ . For storage, the purified protein is typically maintained in a Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -80°C to maintain stability and activity .

How can researchers effectively analyze heme incorporation in YedZ?

To analyze heme incorporation in YedZ, a combination of UV-visible spectroscopy and quantitative heme determination is recommended. The characteristic absorption spectrum of b-type hemes (peaks at 426, 530, and 558 nm when reduced) can be used to confirm heme incorporation. Site-directed mutagenesis of conserved histidine residues, followed by spectroscopic analysis, provides conclusive evidence of the specific heme-binding sites. Researchers should perform reduced minus oxidized difference spectra under anaerobic conditions to clearly observe the characteristic peaks associated with b-type hemes in the reduced state .

What techniques are most effective for studying protein-protein interactions involving YedZ?

Several complementary techniques have proven effective for studying YedZ protein interactions:

  • Chemical cross-linking using reagents such as ethylene glycol-bis-(succinimidylsuccinate) (EGS) followed by SDS-PAGE analysis to visualize complex formation

  • Surface plasmon resonance to quantify binding kinetics and affinity

  • Co-immunoprecipitation to confirm interactions in physiological conditions

  • Structural analysis through X-ray crystallography or cryo-EM for detailed interaction interfaces

When investigating specific interactions, such as between MsrQ and Fre, researchers should include appropriate controls such as unrelated proteins (e.g., lysozyme or BSA) to verify specificity, and test the effect of varying salt concentrations to evaluate the ionic character of the interaction .

How does YedZ function in the bacterial methionine sulfoxide reduction system?

YedZ (MsrQ) functions as an essential component of the MsrPQ system, a two-protein methionine sulfoxide reductase system encoded in the same operon. In this system, MsrQ serves as the membrane-anchored electron donor for the periplasmic MsrP protein, which carries out the actual reduction of methionine sulfoxide. The electron transfer pathway involves Fre, a cytosolic flavin reductase that receives electrons from NADPH and transfers them via FMN to the heme moieties of MsrQ. These electrons are then passed to MsrP, enabling it to catalyze the reduction of oxidized methionine residues in periplasmic proteins . This system represents an important mechanism for repairing oxidative damage to proteins in the bacterial periplasm.

What is the redox potential of YedZ and how can it be measured experimentally?

The redox potential of YedZ can be determined using potentiometric titrations monitored by UV-visible spectroscopy. This involves measuring the absorption spectrum of the protein at different defined potential values established using appropriate redox mediators. For b-type hemes in bacterial proteins similar to YedZ, the redox potentials typically range from -100 to -300 mV versus the standard hydrogen electrode. The experimental setup should include strict anaerobic conditions and use of a platinum electrode coupled with an Ag/AgCl reference electrode for accurate measurements. This information is critical for understanding the thermodynamic constraints of the electron transfer reactions in which YedZ participates.

What factors influence the heme binding and electron transfer properties of YedZ?

Several factors significantly influence the heme binding and electron transfer properties of YedZ:

  • The presence of conserved histidine residues, which serve as axial ligands for the heme iron

  • The local protein environment surrounding the heme, including hydrophobic and electrostatic interactions

  • pH conditions, which affect the protonation state of amino acid residues involved in heme coordination

  • The presence of specific amino acid residues that create the appropriate redox environment

Mutagenesis studies have shown that modification of the conserved histidine residues directly impacts heme binding ability. Additionally, the electron transfer efficiency between the Fre reductase and YedZ heme moieties is influenced by the formation of a specific protein-protein complex, as demonstrated by cross-linking experiments .

What is the phylogenetic distribution of YedZ proteins across bacterial taxa?

YedZ (MsrQ) homologs are widely distributed among proteobacteria, with the highest conservation observed in gamma-proteobacteria including Enterobacteriaceae, Pseudomonadaceae, and Vibrionaceae. The conservation of the MsrPQ system suggests its evolutionary importance in bacterial adaptation to oxidative stress conditions. Genomic analyses indicate that the genes encoding MsrP and MsrQ are typically found in the same operon, further supporting their functional relationship. This phylogenetic distribution provides insights into the evolutionary history of redox systems in bacteria and their adaptation to different ecological niches.

How can recombinant YedZ be utilized in electron transfer system reconstitution experiments?

Recombinant YedZ can be employed in reconstitution experiments to study electron transfer mechanisms by:

  • Incorporating purified YedZ into proteoliposomes or nanodiscs to mimic the native membrane environment

  • Adding purified components of the electron transfer chain (Fre, FMN, NADPH)

  • Monitoring electron transfer using spectroscopic techniques (e.g., stopped-flow spectroscopy)

  • Quantifying the reduction of artificial electron acceptors or natural substrates (MsrP)

For optimal results, researchers should maintain anaerobic conditions during the reconstitution and measurement process. The activity can be measured by monitoring the absorption changes at characteristic wavelengths (426, 530, and 558 nm) that reflect the redox state of the heme groups . This approach allows for detailed kinetic analysis of the electron transfer process and evaluation of factors affecting its efficiency.

What methodological approaches can be used to study the role of YedZ in oxidative stress response?

To investigate the role of YedZ in oxidative stress response, researchers can employ multiple complementary approaches:

ApproachMethodologyExpected Outcome
GeneticConstruction of yedZ deletion mutants and complementation strainsPhenotypic changes in oxidative stress sensitivity
BiochemicalIn vitro assays measuring methionine sulfoxide reduction with purified componentsQuantitative assessment of enzymatic activity
ProteomicMS-based identification of oxidized proteins in wild-type vs. mutant strainsIdentification of physiological substrates
TranscriptomicRNA-seq analysis under oxidative stress conditionsRegulatory networks associated with YedZ function
StructuralSite-directed mutagenesis of conserved residuesStructure-function relationships

When conducting oxidative stress experiments, it's important to use specific oxidants (e.g., HOCl, H₂O₂) at physiologically relevant concentrations and measure both immediate responses and adaptation over time .

How can researchers investigate the potential role of YedZ in bacterial pathogenesis?

To investigate YedZ's role in pathogenesis, researchers should consider:

  • Creating yedZ knockout mutants in pathogenic bacterial strains and evaluating their virulence in appropriate infection models

  • Examining gene expression patterns of yedZ and related genes during host-pathogen interactions

  • Assessing the contribution of YedZ to bacterial survival under host-imposed oxidative stress conditions

  • Investigating whether YedZ contributes to biofilm formation or antibiotic resistance

Since S. proteamaculans has been reported as a phytopathogen causing leaf spot disease , plant infection models could be particularly relevant. Additionally, given the wide distribution of S. proteamaculans in nature, including in insect gut microbiota , investigating its role in colonization of these ecological niches would provide valuable insights into its adaptive functions.

How does the YedZ-containing MsrPQ system interact with other redox systems in bacterial cells?

The YedZ-containing MsrPQ system likely functions as part of an integrated network of redox systems in bacterial cells. It specifically interacts with the cytosolic electron donor Fre, which can provide reducing equivalents from NADPH. This positions the MsrPQ system within the broader cellular redox homeostasis network. Research suggests potential crosstalk between the MsrPQ system and other bacterial defense systems against oxidative stress, such as thioredoxin, glutathione, and other periplasmic redox proteins . The interconnection between these systems ensures redundancy and robustness in the bacterial response to oxidative challenges.

What is the relationship between YedZ activity and other enzymatic systems in S. proteamaculans?

S. proteamaculans possesses various enzymatic systems that may functionally complement or interact with the YedZ-containing MsrPQ system. The bacterium is known to produce multiple bio-degradative enzymes, including chitinases, endoglucanases, proteases, and laccases . The YedZ-MsrP system may work in concert with these enzymes, particularly in environments where breakdown of complex substrates generates oxidative stress. For example, laccase production by S. proteamaculans AORB19 has been demonstrated, with the enzyme showing activity on substrates like guaiacol and ABTS . The complementary activities of these different enzyme systems likely contribute to the ecological versatility of S. proteamaculans.

What are the promising research avenues for therapeutic applications targeting YedZ or related systems?

Future research on YedZ could explore several promising therapeutic applications:

  • Development of specific inhibitors targeting the YedZ-MsrP system as potential antimicrobial agents, particularly against pathogens that rely on this system for virulence

  • Exploration of YedZ homologs as drug targets in pathogenic bacteria, with careful consideration of structural differences from human proteins

  • Investigation of the potential to enhance or modify YedZ activity for biotechnological applications, such as bioremediation of oxidized contaminants

  • Study of YedZ as a model for understanding related human proteins in the NOX family, which are implicated in various diseases

The structural and functional relationship between bacterial YedZ and eukaryotic NOX proteins provides a unique opportunity for comparative studies that could inform drug development strategies .

What technological advances would facilitate deeper understanding of YedZ structure-function relationships?

Several technological advances would significantly enhance our understanding of YedZ:

  • High-resolution structural determination of YedZ in different redox states using cryo-electron microscopy or X-ray crystallography

  • Development of real-time electron transfer monitoring techniques to observe the dynamics of YedZ function

  • Advanced computational modeling to predict electron transfer pathways and protein-protein interaction interfaces

  • Implementation of synthetic biology approaches to create modified YedZ variants with altered specificity or enhanced activity

  • Application of in-cell NMR or other in situ analytical methods to study YedZ in its native environment

These technological advances would provide unprecedented insights into the mechanistic details of YedZ function and its integration within cellular redox networks.

What are the key considerations for reproducing YedZ-related experiments across different research settings?

When reproducing YedZ-related experiments, researchers should carefully consider:

  • Strain-specific variations in YedZ sequence and expression that may affect experimental outcomes

  • The importance of maintaining anaerobic conditions during enzyme activity measurements to prevent spontaneous oxidation

  • The critical role of proper membrane protein handling techniques to preserve YedZ structure and function

  • The need for appropriate controls when studying protein-protein interactions to ensure specificity

  • The impact of buffer composition and pH on heme binding and electron transfer properties

Additionally, researchers should be aware that repeated freezing and thawing of purified YedZ is not recommended, and working aliquots should be stored at 4°C for no more than one week to maintain protein integrity .

How can researchers address common technical challenges in YedZ research?

Researchers can address common technical challenges in YedZ research through these methodological solutions:

  • For difficulties in heterologous expression, employing fusion tags like GFP can help monitor expression levels and membrane integration

  • To overcome solubility issues, optimized membrane protein extraction buffers containing appropriate detergents should be used

  • For challenges in assessing functional activity, coupling YedZ-dependent electron transfer to spectroscopically detectable endpoints provides reliable readouts

  • To ensure reproducibility in protein-protein interaction studies, multiple complementary techniques should be employed, including both in vitro approaches (cross-linking, surface plasmon resonance) and in vivo validation methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.