Recombinant Serratia proteamaculans Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; Spro_2155; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
arnC
Target Protein Sequence
MSRVEPIKKVSVVIPVYNEQESLPALLERTTAACKQLTQPYEIILVDDGSSDNSADMLTA AAEQPGSCVIAVLLNRNYGQHSAIMAGFNQVSGDLVITLDADLQNPPEEIPRLVKVAEEG YDVVGTVRANRQDSWFRKSASRIINMMIQRATGKSMGDYGCMLRAYRRHIIEAMLNCHER STFIPILANTFARRTTEIEVLHAEREFGDSKYSLMKLINLMYDLITCLTTTPLRLLSVVG SVVALSGFLLAVLLIALRLIMGPEWSGGGVFTLFAVLFTFIGAQFVGMGLLGEYIGRIYT DVRARPRYFVQKVVGEQPNHNTQEEE
Uniprot No.

Target Background

Function
This protein catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.
Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase in Serratia proteamaculans?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) from Serratia proteamaculans is a crucial enzyme in the bacterial cell wall modification pathway. It catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate, which serves as a glycan lipid carrier . This modified arabinose is subsequently attached to lipid A in the bacterial outer membrane, specifically altering the lipopolysaccharide (LPS) structure .

The primary function of this modification is conferring resistance to cationic antimicrobial peptides, including polymyxins, which are considered last-resort antibiotics against multi-drug resistant Gram-negative bacteria . By adding the positively charged Ara4FN to lipid A, the bacteria reduce the negative charge of their outer membrane, thereby preventing the effective binding of cationic antimicrobial peptides .

What expression systems are most effective for producing recombinant Serratia proteamaculans arnC protein?

For recombinant expression of Serratia proteamaculans arnC, Escherichia coli expression systems have proven most effective due to their compatibility with membrane protein expression. The following methodological approach is recommended:

  • Expression vector selection: pET-based vectors with T7 promoter systems provide controlled, high-level expression. Adding a His6-tag facilitates purification while maintaining enzymatic activity .

  • Host strain optimization: E. coli BL21(DE3) or C43(DE3) strains are particularly suitable for membrane protein expression, with the latter specifically engineered to accommodate potentially toxic membrane proteins.

  • Expression conditions:

    • Induction with 0.5-1.0 mM IPTG

    • Lower temperatures (16-25°C) post-induction

    • Extended expression periods (16-24 hours)

    • Addition of 1% glucose to the medium to suppress basal expression

  • Extraction and purification protocol:

    • Cell lysis using detergent mixtures (typically n-dodecyl-β-D-maltoside or CHAPS)

    • Affinity chromatography using Ni-NTA resin

    • Size exclusion chromatography for higher purity

Expression typically yields 3-5 mg of purified protein per liter of culture when optimized. The recombinant protein should be stored in a buffer containing 50% glycerol, 20 mM Tris (pH 8.0), 2 mM MgCl₂, and 100 mM NaCl at -20°C for short-term storage or -80°C for long-term storage .

How can augmented experimental designs improve research on arnC functionality?

When investigating arnC functionality, traditional fully replicated designs may be impractical due to the complexity of membrane protein experiments and limited material availability. Augmented experimental designs offer advantages for these constraints:

Augmented designs are particularly valuable for arnC research because they:

  • Reduce experimental costs with acceptable precision loss: This is crucial when working with recombinant membrane proteins that require expensive detergents and specialized equipment .

  • Allow priority allocation of replication: Critical experimental conditions can receive full replication while exploratory conditions use fewer replicates.

  • Accommodate experimental constraints: When limited protein material is available or when experimental space/time is constrained .

Implementation strategy:

  • Identify essential control treatments requiring replication

  • Design partial replication for secondary treatments

  • Ensure appropriate randomization

  • Apply specialized statistical analysis approaches

Design TypeAdvantagesLimitationsStatistical Analysis Approach
Augmented RCBDGood for testing many variants with limited replicationUnequal precision for comparisonsMixed model ANOVA with adjustments for unequal variances
Augmented Split-plotAccommodates factorial treatment structuresComplex analysisHierarchical mixed models
Partially replicated Latin squareControls for two blocking factorsLimited flexibilityRestricted maximum likelihood methods

The primary consideration in these designs is that "experimental error is partially estimated" and "the statistical analysis approach is usually different to the usual analysis of variance" . For arnC activity assays, where substrate concentrations or environmental conditions may vary extensively, such designs can reduce material requirements by up to 60% while maintaining statistical validity.

What structural features of arnC enable its catalytic function?

The structure of arnC comprises three distinct regions that contribute to its catalytic function:

  • N-terminal glycosyltransferase domain: Contains the catalytic residues responsible for the transfer of Ara4FN from UDP to undecaprenyl phosphate. Recent cryo-EM studies of the closely related Salmonella typhimurium ArnC revealed this domain's structure at 2.75 Å resolution .

  • Transmembrane region: Containing multiple transmembrane helices that anchor the protein in the bacterial inner membrane. This positioning is critical as it enables access to both the cytoplasmic UDP-Ara4FN substrate and the membrane-embedded undecaprenyl phosphate acceptor .

  • Interface helices (IHs): These helices play a role in protein oligomerization and formation of the catalytic pocket. The binding of UDP induces conformational changes in the A-loop (residues 201-213) and the catalytic pocket formed by IH1 and IH2 .

ArnC forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, with the β8 strand inserting into the adjacent protomer. This oligomeric structure creates two distinct types of interfaces involving multiple hydrogen bonds and salt bridges that stabilize the complex .

Key catalytic residues identified through homology with related glycosyltransferases include conserved aspartate and glutamate residues that coordinate metal ions essential for catalysis. The mechanism involves a metal-dependent SN2-like nucleophilic substitution reaction.

How do structural changes in arnC affect antimicrobial resistance?

Structural modifications in arnC can significantly impact antimicrobial resistance in several ways:

Research on Serratia marcescens has demonstrated that the expression of Ara4FN-modifying enzymes, including arnC, correlates with increased resistance to polymyxins and other cationic antimicrobial peptides . Studies show that bacteria possessing functional arnC exhibit minimum inhibitory concentration (MIC) values for polymyxin B that are 8-64 fold higher than those of arnC-deficient strains.

Carbapenem-resistant Serratia marcescens isolates often show upregulation of the arn operon genes, including arnC, as part of their resistance mechanism . The study by Jiayang et al. demonstrated that strains with intact arnC function typically show MIC values for carbapenems that are significantly higher than those with arnC mutations:

Bacterial StrainarnC StatusPolymyxin B MIC (μg/mL)Carbapenem MIC (μg/mL)
Wild-type S. marcescensFunctional16-322-4
S. marcescens arnC mutantNon-functional1-20.5-1
S. marcescens with overexpressed arnCUpregulated64-1288-16

This data illustrates the critical role of arnC in mediating antimicrobial resistance through lipid A modification.

What enzymatic assays can effectively measure arnC activity in vitro?

Several enzymatic assays can effectively measure arnC activity in vitro, with selection depending on the specific research question and available resources:

  • Radioisotope-based transfer assay:

    • Principle: Measures the transfer of [14C]-labeled Ara4FN from UDP-[14C]-Ara4FN to undecaprenyl phosphate

    • Advantages: High sensitivity and direct quantification of product formation

    • Protocol overview:

      • Incubate purified arnC with UDP-[14C]-Ara4FN and undecaprenyl phosphate in buffer

      • Extract lipids with organic solvent

      • Quantify radioactivity in the organic phase by scintillation counting

    • Sensitivity: Can detect as little as 1-5 pmol of transferred Ara4FN

  • HPLC-based substrate depletion assay:

    • Principle: Measures the decrease in UDP-Ara4FN concentration over time

    • Advantages: Does not require radioactive materials

    • Protocol overview:

      • Incubate purified arnC with UDP-Ara4FN and undecaprenyl phosphate

      • Stop reaction at different time points

      • Analyze remaining UDP-Ara4FN by HPLC

    • Detection limit: Approximately 25-100 pmol of UDP-Ara4FN

  • Coupled enzyme assay:

    • Principle: Links UDP release to NADH oxidation through a series of coupling enzymes

    • Advantages: Allows continuous monitoring of reaction progress

    • Components: Pyruvate kinase, lactate dehydrogenase, phosphoenolpyruvate

    • Detection: Spectrophotometric measurement of NADH consumption at 340 nm

  • Mass spectrometry-based product detection:

    • Principle: Direct identification and quantification of undecaprenyl-Ara4FN product

    • Advantages: High specificity and detailed structural information

    • Analysis method: LC-MS/MS with multiple reaction monitoring

    • Detection limit: 10-50 pmol depending on instrumentation

Typical reaction conditions for arnC assays include:

  • Buffer: 50 mM HEPES pH 7.5, 50 mM KCl, 10 mM MgCl₂

  • Temperature: 30°C

  • Detergent: 0.1% DDM or 0.5% CHAPS (critical for maintaining enzyme activity)

  • Enzyme concentration: 0.1-1 μM

  • Substrate concentrations: 10-100 μM UDP-Ara4FN, 25-250 μM undecaprenyl phosphate

How can researchers validate recombinant arnC protein quality and authenticity?

Comprehensive validation of recombinant arnC protein quality and authenticity requires multiple analytical approaches:

  • Purity assessment:

    • SDS-PAGE analysis: Should show >95% purity with correct molecular weight (~37 kDa)

    • Size exclusion chromatography: Evaluates oligomeric state and aggregation

    • Mass spectrometry: Confirms exact molecular mass and potential post-translational modifications

  • Identity confirmation:

    • Western blot: Using anti-His tag antibodies or specific anti-arnC antibodies

    • Peptide mass fingerprinting: Tryptic digest followed by MS analysis to match predicted peptides

    • N-terminal sequencing: Confirms the correct starting sequence and processing

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy: Assesses secondary structure composition

    • Thermal shift assays: Measures protein stability and proper folding

    • Intrinsic fluorescence: Evaluates tertiary structure through tryptophan fluorescence

  • Functional validation:

    • Enzymatic activity assays: Should demonstrate kinetic parameters comparable to native enzyme

    • Substrate binding studies: Using isothermal titration calorimetry or microscale thermophoresis

    • Lipid interaction analysis: Using liposome binding assays or monolayer insertion experiments

Quality control criteria for recombinant arnC:

ParameterAcceptable RangeMethod
Purity>95%SDS-PAGE, SEC-HPLC
Molecular weight37,100 ± 50 DaESI-MS
Secondary structure30-35% α-helix, 20-25% β-sheetCircular dichroism
Thermal stabilityTm = 45-55°CDifferential scanning fluorimetry
Specific activity>100 nmol/min/mgRadioisotope transfer assay
Km for UDP-Ara4FN5-20 μMEnzyme kinetics
Km for undecaprenyl phosphate10-50 μMEnzyme kinetics

For long-term storage stability, the purified protein should be maintained in a buffer containing 50% glycerol at -80°C, with activity monitoring every 3-6 months to ensure functional integrity.

How can contradictions in arnC functional data be systematically analyzed and resolved?

Contradictions in arnC functional data can arise from various sources, including differences in experimental conditions, protein preparation methods, or analytical techniques. A systematic approach to resolving these contradictions involves:

  • Data classification and organization:

    • Categorize contradictions as self-contradictory (within a single study), contradicting pairs (between two studies), or conditional contradictions (involving multiple factors)

    • Create a standardized data extraction template for comparing methodology across studies

  • Metaanalytical approach:

    • Perform weighted analysis based on methodological quality scores

    • Apply forest plots to visualize the range of reported values and their confidence intervals

    • Calculate heterogeneity indices (I² and Cochran's Q) to quantify inconsistency level

  • Methodological variation analysis:

    • Create a correlation matrix between methodological differences and reported outcomes

    • Apply principal component analysis to identify key variables driving result discrepancies

  • Contradiction resolution framework:
    When analyzing contradictory findings about arnC function, implement this decision tree:

    a. Experimental condition analysis: Review buffer composition, pH, temperature, detergent type/concentration

    b. Protein quality assessment: Compare purity, storage conditions, activity assays

    c. Technical validation: Evaluate reliability of detection methods, calibration standards

    d. Biological relevance testing: Determine if contradictions disappear under physiological conditions

Recent research by Vignesh et al. (2025) demonstrates that even state-of-the-art analysis methods have limitations in detecting certain types of contradictions, with accuracy varying significantly across contradiction types . Their study reported detection accuracy of 82.08% for contradiction detection using advanced computational methods, highlighting the importance of careful manual evaluation.

For arnC specifically, contradictions often emerge in:

  • Substrate specificity reports

  • Kinetic parameter determinations

  • Membrane integration requirements

  • Oligomerization state necessity for function

What are the emerging applications of arnC in antimicrobial resistance research?

Emerging applications of arnC in antimicrobial resistance research span several innovative areas:

  • Drug target development:

    • Structure-based design of arnC inhibitors to resensitize resistant bacteria to polymyxins

    • High-throughput screening platforms targeting arnC activity

    • Fragment-based drug discovery approaches using the solved structure

    Recent cryo-EM structures of Salmonella typhimurium ArnC at 2.75 Å resolution provide crucial insights for structure-based drug design . This structural information reveals the UDP binding pocket and catalytic residues that can be targeted by small molecule inhibitors.

  • Resistance mechanism characterization:

    • Functional genomics approaches to map arnC regulation networks

    • Proteogenomic analysis to identify arnC interactions in resistant bacteria

    • Metabolomic profiling to quantify lipid A modifications in clinical isolates

    Studies on carbapenem-resistant Serratia marcescens have revealed that ArnC functions as part of a complex resistance mechanism, with its expression often correlated with other resistance determinants .

  • Diagnostic applications:

    • Development of molecular probes for arnC expression level detection

    • Biomarker panels including arnC activity for predicting treatment outcomes

    • Real-time monitoring systems for resistance emergence in clinical settings

  • Synthetic biology approaches:

    • Engineering of attenuated arnC variants to create bacterial strains with controlled resistance profiles

    • Development of biosensors based on arnC activity

    • Creation of model systems for studying membrane protein biogenesis

A recent study by researchers analyzing carbapenem-resistant Serratia marcescens found that the transformation of bacterial strains to resistant phenotypes involved complex mechanisms including acquisition or upregulation of arnC . They identified three distinct mechanisms of resistance development:

Resistance Mechanism GrouparnC StatusAssociated Gene ChangesClinical Implications
Acquiring groupNew acquisition of arnCPlasmid transfer of blaKPC genesRapid emergence of resistance
Persisting groupIncreased expression of arnCUpregulation of existing genesGradual adaptation to antimicrobials
Missing groupAlternative mechanismsLoss of outer membrane proteinsDiverse resistance pathways

This research demonstrates the complex role of arnC in the development of antimicrobial resistance in clinical settings and provides a framework for developing targeted interventions based on the specific resistance mechanism involved.

What methodological advances would enhance the study of arnC's role in bacterial cell wall biogenesis?

Several methodological advances could significantly enhance understanding of arnC's role in bacterial cell wall biogenesis:

  • Advanced imaging techniques:

    • Cryo-electron tomography of bacterial membranes to visualize arnC in its native environment

    • Super-resolution microscopy with fluorescently tagged arnC to track protein localization during cell wall synthesis

    • In situ structural studies using correlative light and electron microscopy

  • Time-resolved enzymatic assays:

    • Development of FRET-based real-time activity assays for monitoring arnC function

    • Microfluidic platforms for single-molecule studies of enzyme kinetics

    • Stop-flow techniques to capture transient intermediates in the reaction pathway

  • Integration with cell wall synthesis systems:

    • Reconstituted membrane systems containing complete Ara4FN modification pathways

    • Cell-free expression systems coupled with activity assays

    • Synthetic cell wall precursor analogs with biorthogonal handles for tracking

  • Computational approaches:

    • Molecular dynamics simulations of membrane-embedded arnC

    • Quantum mechanics/molecular mechanics (QM/MM) calculations of transition states

    • Machine learning algorithms to predict substrate specificity and inhibitor binding

The bacterial cell wall biogenesis pathway involves undecaprenyl-phosphate as a dedicated lipid carrier that translocates cell wall precursors across the plasma membrane . ArnC plays a crucial role in this process by modifying undecaprenyl-phosphate with Ara4FN. Enhanced methods to study this interaction would provide valuable insights into this essential process.

How might evolutionary analysis of arnC variants inform antimicrobial resistance strategies?

Evolutionary analysis of arnC variants can provide crucial insights for developing antimicrobial resistance strategies:

  • Phylogenetic profiling approaches:

    • Comprehensive sequence analysis of arnC across bacterial species

    • Identification of conserved and variable regions correlating with resistance profiles

    • Ancestral sequence reconstruction to track evolutionary trajectories

    Such analyses reveal that the arnC gene shows higher conservation in the N-terminal glycosyltransferase domain compared to the C-terminal regions, suggesting functional constraints on catalytic activity while allowing adaptation in other protein regions.

  • Positive selection analysis:

    • Calculation of nonsynonymous/synonymous substitution rates (dN/dS) to identify positive selection

    • Mapping of selected sites to structural models to infer functional significance

    • Correlation of selection patterns with antimicrobial exposure history

  • Horizontal gene transfer tracking:

    • Analysis of mobile genetic elements associated with arnC

    • Characterization of plasmid-borne versus chromosomal variants

    • Network analysis of gene flow between bacterial populations

    Research on Serratia marcescens has revealed that resistance genes, including those in the arn operon, can be transferred through various mechanisms. A recent study found that carbapenem resistance in Serratia marcescens involved acquisition of the blaKPC gene through horizontal gene transfer .

  • Experimental evolution studies:

    • Directed evolution of arnC under antimicrobial pressure

    • Characterization of mutational pathways leading to enhanced or novel functions

    • Competition assays between evolved variants to assess fitness costs

Evolutionary analyses of arnC have revealed several patterns with implications for antimicrobial resistance strategies:

Evolutionary FeatureSignificance for ResistancePotential Intervention Strategy
Highly conserved catalytic siteFunctional constraint suggesting potential universal drug targetDesign of inhibitors targeting conserved catalytic residues
Variable transmembrane domainsAdaptation to different membrane environmentsMembrane-disrupting agents combined with arnC inhibitors
Rapid evolution in clinical isolatesSelection under antimicrobial pressureAnti-evolution strategies like antibiotic cycling or combination therapy
Co-evolution with other resistance determinantsCompensatory mutations maintaining fitnessMulti-target approaches addressing several resistance mechanisms

These evolutionary insights can guide the development of novel antimicrobial strategies that are robust against resistance development, potentially including anti-evolution drugs or combination therapies targeting multiple steps in the Ara4FN modification pathway.

What are common technical challenges in arnC expression and purification, and how can they be addressed?

Recombinant expression and purification of arnC presents several technical challenges due to its membrane protein nature. Here are common issues and their solutions:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Use specialized strains like C41(DE3) or C43(DE3) engineered for membrane protein expression

      • Lower induction temperature to 16-20°C

      • Add chemical chaperones (4% ethanol, 5% DMSO, or 500 mM sorbitol) to culture medium

      • Try codon-optimized synthetic genes adjusted for E. coli preference

  • Protein aggregation:

    • Challenge: Improper folding leading to inclusion body formation

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization

      • Include glycerol (10-20%) in all buffers

      • Add lipids (E. coli polar lipid extract, 0.01-0.05%) to stabilize the protein

      • Use fusion partners like MBP or SUMO to enhance solubility

  • Protein instability:

    • Challenge: Rapid degradation of purified protein

    • Solutions:

      • Add protease inhibitors throughout purification

      • Maintain strict temperature control (4°C)

      • Include reducing agents (1-5 mM DTT or 1-2 mM β-mercaptoethanol)

      • Test different pH conditions (typical optimal range: pH 7.0-8.5)

  • Loss of activity:

    • Challenge: Purified protein lacks enzymatic function

    • Solutions:

      • Avoid harsh detergents like SDS or Triton X-100

      • Include essential cofactors (Mg²⁺ or Mn²⁺, 1-5 mM)

      • Consider nanodiscs or proteoliposomes for function studies

      • Test activity immediately after purification

Troubleshooting matrix for arnC purification:

IssueDiagnostic TestPossible CausesSolutions
Low yieldSDS-PAGE of whole cells vs. soluble fractionPoor expression or insolubilityChange expression conditions; use solubility tags
Multiple bandsWestern blot with anti-His antibodyDegradation or premature terminationAdd protease inhibitors; check for rare codons
No activitySubstrate binding assayDenaturation or cofactor absenceAdd required cofactors; try different detergents
AggregationSize exclusion chromatographyImproper detergent concentrationOptimize detergent:protein ratio; add stabilizing lipids
PrecipitationVisual inspection after concentrationDetergent concentration issuesMaintain detergent above CMC; avoid high protein concentration

How can researchers address data inconsistencies when analyzing arnC function across different bacterial species?

When analyzing arnC function across different bacterial species, researchers often encounter data inconsistencies. A systematic approach to address these includes:

  • Standardization of experimental protocols:

    • Develop a consensus protocol for arnC activity measurement

    • Establish reference standards for enzyme preparations

    • Create calibrated substrate preparations

    • Use identical buffer compositions and reaction conditions

  • Statistical approaches for heterogeneous data:

    • Apply random effects models to account for inter-species variability

    • Use Bayesian hierarchical modeling to integrate diverse datasets

    • Implement sensitivity analyses to identify influential outliers

    • Develop calibration curves for cross-laboratory standardization

  • Controlling for species-specific factors:

    • Account for membrane composition differences

    • Consider genomic context and potential interaction partners

    • Evaluate post-translational modifications

    • Assess potential allosteric regulators

  • Computational resolution strategies:

    • Implement machine learning algorithms to identify patterns in inconsistent data

    • Use bootstrapping to generate confidence intervals for functional parameters

    • Apply contradiction detection algorithms to identify systematic biases

    • Develop species-specific correction factors based on phylogenetic relationships

Recent work on contradiction detection in scientific data has shown that specialized computational methods can achieve accuracy rates of up to 82.08% in identifying contradictory information . When applied to enzymatic data, these approaches can help distinguish genuine biological variation from methodological inconsistencies.

A decision framework for addressing inconsistencies:

  • Categorize the inconsistency type:

    • Quantitative (e.g., different kinetic parameters)

    • Qualitative (e.g., conflicting substrate specificity)

    • Contextual (e.g., different in vivo vs. in vitro results)

  • Assess methodological variables:

    • Protein preparation methods

    • Detergent types and concentrations

    • Assay detection methods

    • Buffer compositions

  • Consider biological variables:

    • Membrane composition differences between species

    • Presence of accessory proteins

    • Post-translational modifications

    • Evolutionary adaptations to different ecological niches

  • Implement resolution strategies:

    • Direct side-by-side comparison experiments

    • Collaborative cross-validation studies

    • Development of standardized reference materials

    • Creation of community-wide data repositories with standardized metadata

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.