Recombinant Serratia proteamaculans UPF0114 protein Spro_2386 (Spro_2386)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Serratia proteamaculans UPF0114 protein Spro_2386 (Spro_2386) is a protein that, in Serratia proteamaculans, is tagged with histidine and expressed in E. coli . The protein's gene name is Spro_2386, which is also a synonym for UPF0114 protein Spro_2386 . The UniProt ID for this protein is A8GEE7 .

Properties

PropertyValue
SpeciesSerratia proteamaculans
SourceE. coli
TagHistidine (His)
Protein LengthFull Length (1-164 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage
Amino Acid SequenceMERFLENAMYASRWLLAPVYFGLSLALLALSIKFFQEIIHVLPNIFAIAEADLVLTLLSLIDMALVGGLLVMVMFSGYENFVSQLDISDDKEKLSWLGKMDSTSLKSKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDKLTRDKK

Function and Biological Role

The UPF0114 protein Spro_2386 is found in Serratia proteamaculans, a bacterium known for its proteolytic activity and involvement in the spoilage of meat and seafood . Serratia proteamaculans produces several extracellular proteases, including a serralysin-like proteinase, which contribute to its ability to degrade proteins . Proteolytic activity is essential for cytotoxicity in Serratia species . Serratia proteamaculans strain 94 produces a 32-kDa thermostable protealysin able to cleave filamentous actin and matrix metalloprotease MMP2 in human larynx carcinoma HEp-2 cells and can infect HEp-2 cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Spro_2386; UPF0114 protein Spro_2386
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
Spro_2386
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALLALSIKFFQEIIHVLPNIFAIAEADLVLTLLSL IDMALVGGLLVMVMFSGYENFVSQLDISDDKEKLSWLGKMDSTSLKSKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDKLTRDKK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Spro_2386 protein to maintain stability and activity?

For optimal stability of recombinant Spro_2386, the protein should be stored in a Tris-based buffer containing 50% glycerol. The recommended storage temperature is -20°C for regular use, while -80°C is advised for extended storage periods . For working aliquots that will be used within a week, storage at 4°C is acceptable.

It is important to note that repeated freeze-thaw cycles significantly reduce protein stability and should be avoided. Therefore, it's recommended to prepare multiple small working aliquots during initial thawing rather than repeatedly freezing and thawing the entire stock . For reconstitution of lyophilized protein, sterile deionized water should be used to reach a concentration of 0.1-1.0 mg/mL, with glycerol added to a final concentration of 50% for long-term storage .

How is Serratia proteamaculans taxonomically classified and what are its key biological characteristics?

Serratia proteamaculans is a gram-negative, facultative aerobic, motile, non-sporulating bacterium belonging to the family Enterobacteriaceae . It is chemoorganotrophic and mesophilic, capable of growing at refrigeration temperatures (psychrotrophic) .

The organism has been isolated from various environmental sources, including plant rhizospheres and spoiled refrigerated foods, particularly seafood products . The genome of S. proteamaculans strain S4 consists of a 5,324,944 bp circular chromosome and a 129,797 bp circular plasmid, containing a total of 5,008 genes on the chromosome and 134 genes on the plasmid .

S. proteamaculans possesses a LuxI/LuxR-type quorum sensing system consisting of SprI (AHL synthase) and SprR (regulatory protein), which regulates various cellular processes including chitinolytic activity, protease production, swimming motility, and cellular fatty acid composition .

How might quorum sensing in Serratia proteamaculans influence the expression and function of Spro_2386?

The QS system in S. proteamaculans involves the SprI/SprR regulatory pair, where SprI functions as an N-acyl-homoserine lactone (AHL) synthase and SprR as a regulatory protein . The system regulates numerous cellular functions including protease activity, motility, and fatty acid composition .

To investigate potential QS regulation of Spro_2386:

  • Comparative Transcriptomics:

    • Analyze Spro_2386 gene expression in wild-type versus sprI mutant strains using RT-qPCR

    • Compare expression at different growth phases to identify population density-dependent regulation

    • Methods should follow protocols similar to those used for other S. proteamaculans genes where primers specific to Spro_2386 (similar to primers used for 16S rRNA, pigA, and swrW genes) would be designed

  • Promoter Analysis:

    • Examine the Spro_2386 promoter region for spr-box-like sequences (similar to the lux-box)

    • If identified, perform DNA-binding assays with purified SprR protein to test direct regulation

    • This approach would be analogous to studies of other QS-regulated genes in S. proteamaculans and related bacteria

  • Proteomic Analysis:

    • Compare protein abundance profiles between wild-type and QS-deficient mutants using methods like QuaNPA (Quantitative Analysis of the Newly Synthesized Proteome)

    • This would reveal if Spro_2386 is differentially expressed in response to QS signals

The findings from these approaches would provide valuable insights into the potential role of Spro_2386 in population density-dependent cellular processes in S. proteamaculans.

What experimental design would be most effective for determining the membrane topology and subcellular localization of Spro_2386?

Determining membrane topology and subcellular localization of Spro_2386 requires a multi-faceted experimental approach:

  • Computational Prediction Analysis:

    • Begin with in silico analyses using tools like TMHMM, TopPred, or HMMTOP to predict transmembrane domains

    • Use SignalP to determine if there's a signal peptide

    • These analyses would provide initial hypotheses about protein orientation and localization

  • Biochemical Fractionation:

    • Perform subcellular fractionation to separate cytoplasmic, periplasmic, inner membrane, and outer membrane fractions

    • Use Western blotting with anti-Spro_2386 antibodies to determine which fraction contains the protein

    • Include known markers for each cellular compartment as controls

  • Protease Accessibility Studies:

    • Treat intact cells, spheroplasts, and membrane vesicles with proteases like trypsin

    • Compare protease protection patterns to determine which domains are accessible

    • Analyze fragments by mass spectrometry for precise topology mapping

  • Fluorescence Microscopy:

    • Create GFP-Spro_2386 fusion proteins (both N- and C-terminal fusions)

    • Visualize localization in live cells

    • Co-localize with known membrane markers

    • Use super-resolution microscopy for detailed localization

  • Cysteine Scanning Mutagenesis:

    • Systematically replace amino acids with cysteine across the protein

    • Treat with membrane-permeable and -impermeable sulfhydryl reagents

    • Analyze accessibility patterns to determine which regions face cytoplasm versus periplasm

This comprehensive approach would provide robust evidence for the membrane topology and subcellular localization of Spro_2386, critical information for understanding its function.

How can researchers effectively analyze changes in Spro_2386 expression under different environmental conditions?

To effectively analyze Spro_2386 expression changes across environmental conditions, a systematic approach combining transcriptomic and proteomic methods is recommended:

  • Experimental Design Considerations:

    • Apply statistical principles to determine appropriate sample sizes and replicates

    • Include both biological and technical replicates for robust analysis

    • Design time-course experiments to capture dynamic responses

  • Transcriptional Analysis:

    • RT-qPCR: Develop Spro_2386-specific primers (similar to methodologies used for other S. proteamaculans genes)

    • RNA-Seq: For genome-wide context of expression changes

    • Use reference genes like 16S rRNA for normalization

    • Apply the ΔΔCt method for relative quantification

  • Proteomic Analysis:

    • Apply pulse-labeling techniques with clickable amino acids (like AHA) combined with SILAC labeling for quantifying newly synthesized proteins

    • Implement the QuaNPA (Quantitative Analysis of the Newly Synthesized Proteome) workflow for high-throughput assessment

    • Use data-independent acquisition (DIA) mass spectrometry for consistent quantification across samples

  • Data Analysis Framework:

    • Begin with exploratory data analysis to identify patterns without assumptions

    • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

    • Calculate effect sizes beyond p-values to determine biological significance

    • Use multivariate analysis to identify relationships between Spro_2386 expression and other variables

  • Visualization Methods:

    • Create frequency histograms and distributions to visualize expression variability

    • Develop heatmaps for time-course or multi-condition experiments

    • Plot mean values with standard deviation error bars for direct comparisons

This methodological approach provides a comprehensive framework for analyzing Spro_2386 expression changes while adhering to rigorous statistical principles to ensure reliable and reproducible results.

What are the challenges and optimal approaches in designing a structural study of Spro_2386 using X-ray crystallography or cryo-EM?

Designing a structural study of Spro_2386 presents several challenges due to its membrane-associated nature. Here's a methodological approach addressing these challenges:

  • Protein Production Optimization:

    • Expression Systems: Test multiple systems including E. coli strains optimized for membrane proteins (C41/C43), insect cells, and mammalian cells

    • Fusion Partners: Incorporate stability-enhancing fusion partners (MBP, SUMO) to improve folding and solubility

    • Detergent Screening: Systematically evaluate detergents (DDM, LMNG, GDN) for extraction while maintaining native structure

  • Protein Engineering for Crystallography:

    • Construct Design: Create truncation constructs removing flexible regions identified by HDX-MS or limited proteolysis

    • Surface Entropy Reduction: Introduce mutations that replace surface clusters of high-entropy residues with alanines

    • Thermostability Screening: Use CPM thermal shift assays to identify stabilizing conditions

  • Cryo-EM Specific Considerations:

    • Sample Homogeneity: Apply GraFix or amphipol reconstitution to reduce conformational heterogeneity

    • Particle Size Enhancement: Consider using antibody fragments (Fab) to increase molecular weight above the detection limit

    • Vitrification Optimization: Test multiple grid types and blotting conditions to prevent preferred orientation issues

  • Crystallization Approaches:

    • Lipidic Cubic Phase: For membrane proteins, LCP crystallization often yields better results than vapor diffusion

    • High-Throughput Screening: Use robotic systems to screen thousands of conditions with minimal protein

    • In Meso Phase Diagram: Map phase behavior to identify optimal crystallization space

  • Validation Strategy:

    • Complementary Techniques: Validate structural models with SAXS, NMR, or crosslinking mass spectrometry

    • Functional Assays: Design mutation studies based on structural insights to confirm functional relevance

This comprehensive approach addresses the specific challenges of membrane protein structural biology while providing a practical roadmap for researchers attempting to determine the structure of Spro_2386.

How can researchers investigate potential protein-protein interactions involving Spro_2386?

Investigating protein-protein interactions (PPIs) involving Spro_2386 requires a multi-technique approach that accounts for its likely membrane association:

  • Co-Immunoprecipitation (Co-IP) Strategy:

    • Generate specific antibodies against Spro_2386 or use epitope-tagged versions

    • Apply gentle membrane solubilization with digitonin or CHAPS to preserve interactions

    • Identify binding partners by mass spectrometry

    • Validate with reciprocal Co-IP experiments

  • Proximity-Based Labeling:

    • Create fusion proteins with BioID or APEX2 enzymes

    • Express in S. proteamaculans under native conditions

    • Identify proteins in proximity to Spro_2386 by streptavidin purification and MS

    • This approach is particularly valuable for capturing transient interactions

  • Bacterial Two-Hybrid System:

    • Adapt membrane-specific two-hybrid systems like BACTH (Bacterial Adenylate Cyclase Two-Hybrid)

    • Screen against genomic libraries to identify interaction partners

    • Quantify interaction strength using β-galactosidase assays

    • Perform systematic domain mapping to identify interaction interfaces

  • Pull-Down Assays with Recombinant Proteins:

    • Express Spro_2386 with affinity tags (His, GST, MBP)

    • Perform pull-downs from S. proteamaculans lysates

    • Test interactions with candidate proteins identified in other assays

    • Include appropriate controls for non-specific binding

  • Surface Plasmon Resonance (SPR) for Kinetic Analysis:

    • Immobilize purified Spro_2386 on sensor chips

    • Determine binding kinetics (kon, koff) and affinity (KD) for confirmed interactors

    • Test effects of environmental factors (pH, salt concentration) on interactions

  • Crosslinking Mass Spectrometry:

    • Apply membrane-permeable crosslinkers to intact cells

    • Identify crosslinked peptides by MS/MS

    • Map interaction surfaces at amino acid resolution

    • This approach can capture in vivo interactions in their native context

By implementing this systematic approach, researchers can comprehensively characterize the interactome of Spro_2386, providing crucial insights into its biological function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.