Recombinant Serratia proteamaculans UPF0208 membrane protein Spro_3315 (Spro_3315)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice is specifically requested. Advance notice is required for dry ice shipments, which incur additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Spro_3315; UPF0208 membrane protein Spro_3315
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
Spro_3315
Target Protein Sequence
MTSKPSGSVSWFQVFQRGQHYMKTWPSDKRLAPVFPENRVASATRFAVRFMPPLAVFTLT WQIALGGQLGPAIATALFACSMPMQGLWWLGRRSVTPLPPTLLQWFHEVRNKLAEAGQAV APVEGTPTYQALADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Serratia proteamaculans and why is it significant for research?

Serratia proteamaculans is a gram-negative bacterium belonging to the Enterobacteriaceae family. It is significant for research due to its diverse enzymatic activities and potential roles in various biological processes. S. proteamaculans produces several bioactive compounds including proteases that have been linked to cytotoxic properties. For example, S. proteamaculans strain 94 produces a 32-kDa thermostable protealysin capable of cleaving filamentous actin and matrix metalloprotease MMP2 in human larynx carcinoma cells . This bacterium has also demonstrated capability for eukaryotic cell invasion, making it an important subject for studies on bacterial pathogenesis and protein function . Research on its proteins, including membrane proteins like UPF0208, contributes to our understanding of bacterial physiology and potential applications in biotechnology.

How do I establish a suitable experimental design for studying UPF0208 membrane proteins?

Establishing a suitable experimental design for studying UPF0208 membrane proteins requires a systematic approach. Begin by clearly defining your research question and identifying the specific aspects of the protein you want to investigate (structure, function, expression patterns, etc.). List your independent variables (e.g., experimental conditions) and dependent variables (e.g., protein expression levels, activity) . Consider potential confounding variables that might affect your results and develop strategies to control them.

A robust experimental design for membrane protein research typically includes:

  • Comparative analysis between wild-type and mutant strains

  • Controlled expression systems (inducible promoters)

  • Multiple methodologies for protein detection and characterization

  • Appropriate controls for each experimental condition

For example, when studying proteolytic activity in Serratia species, researchers have used transposon mutagenesis to create mutant libraries, followed by screening on selective media such as skim milk agar plates to identify mutants with altered protease activity . This approach could be adapted for studying membrane proteins by using appropriate selective conditions relevant to the suspected function of the UPF0208 protein.

What extraction and purification methods are most effective for Serratia proteamaculans membrane proteins?

Extraction and purification of membrane proteins from Serratia proteamaculans requires specialized techniques due to their hydrophobic nature and integration within the lipid bilayer. The most effective methods typically involve:

  • Initial cell disruption using sonication, French press, or enzymatic lysis

  • Differential centrifugation to isolate membrane fractions

  • Solubilization using detergents (e.g., n-dodecyl-β-D-maltoside, Triton X-100)

  • Purification through affinity chromatography when working with recombinant tagged proteins

For recombinant expression, utilizing expression systems that facilitate proper membrane protein folding is crucial. The yeast expression system has proven effective for some Serratia proteins, as evidenced by the successful production of recombinant Serratia proteamaculans UPF0234 protein Spro_1084 in yeast . When designing a purification strategy, consider adding stabilizing agents to maintain protein integrity throughout the process, and verify purity using SDS-PAGE and Western blotting.

What expression systems are recommended for recombinant production of Serratia proteamaculans membrane proteins?

Several expression systems can be used for recombinant production of Serratia proteamaculans membrane proteins, each with distinct advantages:

Expression SystemAdvantagesConsiderations for Membrane Proteins
E. coliHigh yield, simple genetics, economicalMay require specialized strains (C41/C43) for membrane proteins
Yeast (P. pastoris, S. cerevisiae)Eukaryotic processing, high density cultureDemonstrated success with Serratia proteins
Insect cellsAdvanced folding machinery, post-translational modificationsHigher cost, longer production time
Cell-free systemsAvoids toxicity issues, direct access to reactionLower yields for membrane proteins

The selection of an appropriate expression system depends on your specific research goals. For functional studies requiring proper folding and membrane insertion, eukaryotic systems like yeast may be preferable. For structural studies requiring large quantities, optimized bacterial systems with specific membrane protein expression enhancements may be more suitable.

How can I investigate the function of UPF0208 membrane protein through gene knockout or silencing approaches?

Investigating UPF0208 membrane protein function through gene knockout or silencing requires precise genetic manipulation techniques. For Serratia proteamaculans, a well-established approach involves using homologous recombination with a suicide vector to create gene disruptions. This method has been successfully employed for the inactivation of the sprI gene in S. proteamaculans 94 .

The procedure typically involves:

  • PCR amplification of the target gene region

  • Cloning this fragment into a suicide vector (e.g., pEX18Tc)

  • Inserting an antibiotic resistance cassette (e.g., gentamicin resistance gene) into the target gene

  • Transferring the constructed plasmid into S. proteamaculans through conjugation

  • Selecting for double recombinants that have incorporated the disrupted gene into their chromosome

The effectiveness of gene knockout can be verified through PCR, Southern blotting, and phenotypic analysis. For instance, when the sprI gene was inactivated in S. proteamaculans 94, researchers observed the absence of AHL synthesis, decreased chitinolytic activity, reduced swimming motility, and changes in extracellular proteolytic activity . Similar phenotypic analyses would be valuable for determining the function of UPF0208 membrane protein.

What techniques are most effective for analyzing protein-protein interactions involving UPF0208 membrane proteins?

Analyzing protein-protein interactions involving membrane proteins presents unique challenges due to their hydrophobic nature. The most effective techniques include:

  • Co-immunoprecipitation with membrane-specific modifications: Using crosslinking agents before solubilization to capture transient interactions, followed by gentle detergent extraction.

  • Proximity-based labeling approaches: BioID or APEX2 fusion proteins that biotinylate nearby proteins when activated, allowing identification of the proximal interactome of the membrane protein.

  • Split reporter assays: Modified membrane yeast two-hybrid or split-GFP systems specifically designed for membrane protein interaction analysis.

  • Förster Resonance Energy Transfer (FRET): For analyzing interactions in intact membranes, providing spatial resolution.

When investigating quorum sensing systems in Serratia proteamaculans, researchers identified interactions between regulatory proteins by analyzing their genetic organization, finding that sprI and sprR genes were transcribed convergently with partially overlapping reading frames . Similar genetic arrangement analysis could provide insights into potential interaction partners for UPF0208 membrane proteins.

How does the quorum sensing system in Serratia proteamaculans affect the expression and function of membrane proteins?

The quorum sensing (QS) system in Serratia proteamaculans plays a crucial regulatory role that likely extends to membrane protein expression and function. In S. proteamaculans 94, the QS system is comprised of the sprI and sprR genes, which encode an AHL synthase and a receptor regulatory protein, respectively . These components orchestrate population-density-dependent gene expression through N-acyl-L-homoserine lactone signal molecules.

Research has shown that inactivation of the sprI gene in S. proteamaculans leads to profound physiological changes, including:

  • Absence of AHL synthesis

  • Loss of chitinolytic activity and swimming motility

  • Decreased extracellular proteolytic activity

  • Altered cellular fatty acid composition

  • Reduced ability to suppress fungal plant pathogens

These findings suggest that membrane proteins involved in motility, transport, and cellular metabolism are likely regulated by the QS system. When studying UPF0208 membrane proteins, it would be valuable to investigate:

  • Differential expression patterns of the membrane protein in wild-type versus QS-deficient mutants

  • Presence of spr-box sequences (analogous to lux-box) in the promoter region of the UPF0208 gene

  • Changes in membrane protein localization or complex formation under different population densities

Understanding these QS-dependent regulations could provide insights into the physiological context in which the UPF0208 membrane protein functions.

What bioinformatic approaches can reveal structural and functional insights about UPF0208 membrane proteins?

Comprehensive bioinformatic analysis can provide valuable insights into the structure and function of UPF0208 membrane proteins. An effective analytical pipeline should include:

  • Sequence analysis and homology identification:

    • Multiple sequence alignment with homologous proteins

    • Phylogenetic analysis to identify evolutionary relationships

    • Identification of conserved domains and motifs

  • Structural prediction:

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Ab initio and homology-based 3D structure modeling (AlphaFold2, I-TASSER)

    • Molecular dynamics simulations to predict membrane interactions

  • Functional prediction:

    • Gene neighborhood analysis to identify functionally related genes

    • Protein-protein interaction network construction

    • Gene ontology enrichment analysis

When studying Serratia proteins, researchers have used PCR amplification with degenerate primers designed from conserved regions, followed by sequence comparison with GenBank database entries to identify and characterize genes . This approach, combined with modern bioinformatic tools, can provide a foundation for understanding the potential functions of UPF0208 membrane proteins.

What are the best practices for designing primers for PCR amplification of Serratia proteamaculans membrane protein genes?

Designing effective primers for PCR amplification of Serratia proteamaculans membrane protein genes requires careful consideration of several factors:

  • Primer specificity:

    • Design primers based on conserved regions identified through multiple sequence alignments

    • Perform in silico PCR using the S. proteamaculans genome to ensure specificity

    • Include 18-25 nucleotides of gene-specific sequence

  • Optimal primer properties:

    • Maintain GC content between 40-60%

    • Avoid secondary structures and primer-dimer formation

    • Ensure similar melting temperatures (Tm) between forward and reverse primers (within 2-5°C)

  • Special considerations for membrane protein genes:

    • Avoid designing primers within highly hydrophobic regions, which may affect PCR efficiency

    • For cloning purposes, add appropriate restriction sites with 3-6 additional nucleotides at the 5' end

For example, when identifying and cloning the sprI and sprR genes in S. proteamaculans 94, researchers used degenerate primers (deg SprI-F and deg SprI-R) and a specific PCR program: 94°C for 3 min, followed by 30 cycles at 94°C for 20 s, 50°C for 40 s, and 72°C for 40 s . Similar approaches can be applied when targeting UPF0208 membrane protein genes.

How should I optimize the expression conditions for recombinant Serratia proteamaculans membrane proteins?

Optimizing expression conditions for recombinant Serratia proteamaculans membrane proteins requires systematic testing of multiple parameters to maximize yield while maintaining proper folding and functionality:

ParameterVariables to TestConsiderations
Expression strainBL21(DE3), C41(DE3), C43(DE3), RosettaC41/C43 are engineered for membrane protein expression
Induction temperature16°C, 25°C, 30°C, 37°CLower temperatures often improve folding
Inducer concentration0.1-1.0 mM IPTG or alternative inducersLower concentrations may reduce toxicity
Media compositionLB, TB, 2xYT, auto-inductionRich media can improve yields
Induction timeEarly log, mid-log, late log phaseTiming affects membrane integration
Expression duration4h, 8h, overnight, 24h+Longer may not always be better

When working with yeast expression systems, which have been successful for Serratia proteins , additional considerations include:

  • Selection of appropriate promoter (constitutive vs. inducible)

  • Optimization of culture conditions (pH, aeration, carbon source)

  • Codon optimization for the host organism

Begin with small-scale expression trials to identify optimal conditions before scaling up. Monitor protein expression through Western blotting or activity assays. For membrane proteins, it's crucial to verify proper membrane localization through fractionation studies.

What protocols are recommended for analyzing the localization and topology of UPF0208 membrane proteins?

Analyzing the localization and topology of UPF0208 membrane proteins requires specialized techniques that preserve membrane architecture while providing specific information about protein orientation:

  • Cell fractionation and Western blotting:

    • Separate cytoplasmic, periplasmic, and membrane fractions through differential centrifugation

    • Analyze protein distribution across fractions using specific antibodies

    • Use membrane-specific markers (e.g., OmpA) as controls

  • Protease accessibility assays:

    • Treat intact cells, spheroplasts, or inverted membrane vesicles with proteases

    • Analyze protease-protected fragments to determine exposed regions

    • Compare results with computational topology predictions

  • Reporter fusion analysis:

    • Create fusions with reporters such as GFP, PhoA, or LacZ at different positions

    • Analyze activity patterns to determine cytoplasmic vs. periplasmic localization

    • Use multiple fusion points to map complete topology

  • Fluorescence microscopy for localization:

    • Visualize GFP-tagged proteins in living cells

    • Use membrane-specific dyes for co-localization

    • Perform time-lapse imaging to assess dynamic behavior

When studying quorum sensing systems in S. proteamaculans, researchers analyzed gene organization and expression patterns to understand the functional relationships between components . Similar approaches combining genetic and biochemical methods would be valuable for determining the localization and functional context of UPF0208 membrane proteins.

How should I approach the analysis of complex datasets generated from membrane protein research?

Analyzing complex datasets from membrane protein research requires a systematic approach that integrates multiple data types while accounting for the unique challenges of membrane protein biology:

  • Quality control and normalization:

    • Assess data quality using appropriate metrics for each technique

    • Apply technique-specific normalization to account for batch effects

    • Consider the hydrophobic nature of membrane proteins when interpreting results

  • Integration of multiple data types:

    • Combine structural predictions with experimental data

    • Cross-validate findings using orthogonal techniques

    • Use network analysis to place membrane proteins in biological context

  • Statistical analysis and visualization:

    • Apply appropriate statistical tests based on data distribution

    • Visualize data using multiple representations (heat maps, network diagrams)

    • Control for multiple testing when analyzing large datasets

  • Functional interpretation:

    • Compare phenotypic changes in mutants with molecular data

    • Analyze co-expression networks to identify functionally related genes

    • Integrate findings with existing knowledge about similar proteins

When studying proteolytic activity in Serratia species, researchers used transcriptome sequencing (RNA-seq) to analyze gene expression in mutants with altered virulence, complemented by quantitative reverse transcription-PCR (qRT-PCR) to determine optimal expression conditions for specific genes . This multi-faceted approach exemplifies the integration of different techniques to gain comprehensive insights.

What are the most common pitfalls in interpreting results from membrane protein experiments and how can they be avoided?

  • Detergent-induced artifacts:

    • Pitfall: Detergents used for solubilization can alter protein structure and function

    • Solution: Compare results using multiple detergents; validate with complementary techniques in native membranes

  • Overexpression effects:

    • Pitfall: Non-physiological expression levels can cause mislocalization or aggregation

    • Solution: Use inducible systems with titratable expression; confirm results with native expression levels

  • Incomplete characterization of mutant phenotypes:

    • Pitfall: Attributing phenotypes to direct effects when they may be indirect

    • Solution: Perform complementation studies; analyze multiple aspects of cellular physiology

  • Misinterpretation of protein-protein interactions:

    • Pitfall: Identifying false positives due to hydrophobic interactions

    • Solution: Use stringent controls; validate interactions with multiple techniques

  • Overlooking post-translational modifications:

    • Pitfall: Missing regulatory mechanisms specific to membrane proteins

    • Solution: Employ techniques that preserve and detect modifications (MS-based approaches)

In studies of Serratia proteamaculans, researchers observed that inactivation of the sprI gene led to multiple phenotypic changes, including altered proteolytic activity, motility, and fatty acid composition . This highlights the importance of comprehensive phenotypic analysis when interpreting the effects of genetic modifications.

How can I validate the function of recombinant Serratia proteamaculans UPF0208 membrane protein in heterologous systems?

Validating the function of recombinant Serratia proteamaculans UPF0208 membrane protein in heterologous systems requires multiple approaches to ensure that observed activities reflect the native function:

  • Complementation studies:

    • Generate knockout mutants in S. proteamaculans

    • Introduce the recombinant protein and assess restoration of phenotype

    • Test multiple expression levels and conditions

  • Functional assays in relevant contexts:

    • Design assays based on predicted functions or homology

    • Include appropriate positive and negative controls

    • Ensure proper membrane integration in the heterologous system

  • Structure-function relationship analysis:

    • Create targeted mutations in conserved regions

    • Assess the impact on protein function and localization

    • Correlate functional changes with structural predictions

  • Comparative analysis across species:

    • Test homologous proteins from related organisms

    • Identify conserved functional properties

    • Establish evolutionary relationships between structure and function

When investigating proteolytic activity in Serratia species, researchers identified mutants deficient in protease activity through transposon mutagenesis and confirmed their phenotypes using both plate-based assays and liquid azocasein assays . Similarly, validating UPF0208 membrane protein function would benefit from multiple complementary approaches.

What are the emerging technologies that could advance research on Serratia proteamaculans membrane proteins?

Several emerging technologies hold promise for advancing research on Serratia proteamaculans membrane proteins:

  • Cryo-electron microscopy for structural determination of membrane proteins without crystallization

  • Single-cell proteomics for analyzing membrane protein expression at unprecedented resolution

  • CRISPR-Cas9 genome editing for precise genetic manipulation in Serratia species

  • Native mass spectrometry for analyzing intact membrane protein complexes

  • Artificial intelligence-based structure prediction tools like AlphaFold2 for modeling membrane proteins

  • Nanodiscs and lipid cubic phase technologies for stabilizing membrane proteins in near-native environments

  • Microfluidic systems for high-throughput functional analysis of membrane proteins

These technologies, when applied to the study of UPF0208 membrane proteins, could provide unprecedented insights into their structure, function, and biological significance in Serratia proteamaculans.

How can findings from UPF0208 membrane protein research contribute to broader understanding of bacterial physiology?

Research on UPF0208 membrane proteins has the potential to contribute significantly to our understanding of bacterial physiology in several ways:

  • Cell envelope biology and homeostasis:

    • Membrane proteins often play critical roles in maintaining cell envelope integrity

    • Understanding UPF0208 function may reveal new mechanisms of membrane organization

  • Bacterial adaptation and stress responses:

    • Membrane proteins are at the interface between bacteria and their environment

    • UPF0208 proteins may be involved in sensing or responding to environmental changes

  • Bacterial communication and community behavior:

    • Research on Serratia proteamaculans has revealed sophisticated quorum sensing systems

    • UPF0208 membrane proteins may participate in these regulatory networks

  • Evolution of bacterial protein families:

    • Comparative studies of UPF protein families across species can reveal evolutionary patterns

    • Understanding conserved functions may provide insights into bacterial evolution

By integrating UPF0208 membrane protein research with broader studies of bacterial physiology, researchers can contribute to a more comprehensive understanding of microbial life and potentially identify new targets for antimicrobial development or biotechnological applications.

What are the most promising applications of Serratia proteamaculans membrane protein research in biotechnology and medicine?

Research on Serratia proteamaculans membrane proteins presents several promising applications in biotechnology and medicine:

  • Novel antimicrobial development:

    • Membrane proteins often serve as potential targets for antimicrobial compounds

    • Understanding unique aspects of Serratia membrane biology could lead to selective targeting

  • Enzyme technology and biocatalysis:

    • S. proteamaculans produces various enzymes with industrial potential

    • Membrane-associated enzymes may offer advantages for certain biotransformations

  • Biosensor development:

    • Membrane proteins involved in sensing environmental signals could be adapted for biosensor applications

    • UPF0208 proteins might function in detection systems if their sensory capabilities are established

  • Understanding bacterial pathogenesis:

    • S. proteamaculans has demonstrated capability for eukaryotic cell invasion

    • Membrane proteins likely play critical roles in host-pathogen interactions

  • Protein expression technology:

    • Insights from successful expression of Serratia membrane proteins in heterologous systems

    • Development of improved methods for difficult-to-express membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.