Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675 (Spro_2675)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Serratia proteamaculans is an opportunistic pathogen known for its ability to invade eukaryotic cells, often leveraging outer membrane proteins (OMPs) such as OmpX to interact with host receptors like β1 integrins and EGFR . Recombinant Spro_2675 is a membrane protein derived from S. proteamaculans UPF0259, produced via genetic engineering for research purposes. Its primary role remains undefined in current literature, but its recombinant form is commercialized for use in assays, such as ELISA .

Core Properties

ParameterValue/Description
SpeciesSerratia proteamaculans (strain 568)
Uniprot IDA8GF86
Tag TypeDetermined during production (not specified)
Sequence Length250 amino acids (partial sequence shown: MPITANTLYRDSFNFFRNQLTSILmLALLTAFISVLLNQAFSPDVEQLKILSATEGDFAA SAGMGIQEIIQQMTPEQQMVLLKVSAAATFSALVGNVLLVGGmLTLIRLVSQGQRISALR AIGASAPELPRLLLLLFICTLLIQLGLTLFVVPGVIMAIAFSLAPVITATDKKGVFASIK LSCKLAFANARVIVPAMmLWLAAKLLVLFMVSHLSVLTPNVASVVLTALSNLVSALLLIY LFRLYmLLRS)
Storage BufferTris-based buffer with 50% glycerol, optimized for stability
Storage Conditions-20°C (avoid repeated freeze-thaw cycles)

Functional Insights

While specific functional studies on Spro_2675 are lacking, S. proteamaculans membrane proteins are critical for host-pathogen interactions. For example, OmpX binds to EGFR and β1 integrins, facilitating bacterial invasion . Spro_2675’s role may involve similar host-cell interactions, though this remains speculative.

Production and Purification

Recombinant Spro_2675 is synthesized via heterologous expression, likely in E. coli or other bacterial systems. Key considerations include:

  • Signal Peptides: Optimal periplasmic expression often requires signal peptides (e.g., OmpA, DsbA) to direct secretion .

  • Production Rates: Titratable systems (e.g., rhamnose-inducible promoters) help avoid Sec-translocon saturation, enhancing yields .

  • Purification: Methods such as IMAC or SEC are standard for His-tagged recombinant proteins .

Diagnostic and Therapeutic Relevance

ApplicationDetails
ELISA DevelopmentCommercialized kits for detecting Spro_2675 antibodies or antigens
Structural StudiesPotential use in membrane protein topology analyses (e.g., protease protection assays)
Pathogenicity ModelsHypothetical use in studying S. proteamaculans invasion mechanisms analogous to OmpX

Limitations

  • Functional Ambiguity: No studies directly link Spro_2675 to virulence factors or metabolic pathways.

  • Availability: Currently marked as "Not Available For Sale," limiting experimental access .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
Spro_2675; UPF0259 membrane protein Spro_2675
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
Spro_2675
Target Protein Sequence
MPITANTLYRDSFNFFRNQLTSILMLALLTAFISVLLNQAFSPDVEQLKILSATEGDFAA SAGMGIQEIIQQMTPEQQMVLLKVSAAATFSALVGNVLLVGGMLTLIRLVSQGQRISALR AIGASAPELPRLLLLLFICTLLIQLGLTLFVVPGVIMAIAFSLAPVITATDKKGVFASIK LSCKLAFANARVIVPAMMLWLAAKLLVLFMVSHLSVLTPNVASVVLTALSNLVSALLLIY LFRLYMLLRS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675 is a full-length (1-250 amino acids) membrane protein derived from the gram-negative bacterium Serratia proteamaculans. The protein is classified as part of the UPF0259 protein family with unknown function, bearing the UniProt ID A8GF86. When expressed recombinantly, it is typically fused to an N-terminal His tag to facilitate purification and detection . The protein exists in a lyophilized powder form when commercially supplied and requires appropriate reconstitution before experimental use .

For research applications, it's important to note that this recombinant protein is produced in E. coli expression systems, which may influence its post-translational modification profile compared to native protein from S. proteamaculans . This characteristic should be considered when designing experiments focused on protein function and interaction studies.

What expression systems are suitable for producing Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Multiple expression systems can be utilized for the production of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675, each with distinct advantages:

Expression SystemAdvantagesConsiderationsRecommended For
E. coliHighest yield, shorter turnaround time, cost-effectiveLimited post-translational modificationsBasic functional studies, structural analyses
YeastGood yield, some post-translational modifications, shorter turnaround timeMore expensive than E. coliStudies requiring eukaryotic modifications
Insect cells with baculovirusMore complex post-translational modificationsLonger production time, higher costStudies focused on protein folding, activity
Mammalian cellsMost comprehensive post-translational modificationsLongest production time, highest costStudies requiring native-like activity

How should I design experiments to study the function of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

When designing experiments to study this membrane protein's function, follow these methodological steps based on established experimental design principles:

  • Formulate a clear research question and hypothesis: Define specific variables related to Spro_2675 function. For example, if investigating membrane localization, your independent variable might be protein concentration and your dependent variable might be membrane integration efficiency .

  • Control extraneous variables: For membrane proteins, critical variables to control include:

    • Lipid composition of reconstitution membranes

    • Buffer pH and ionic strength

    • Temperature during reconstitution and assays

    • Detergent concentration during purification

    • Presence of contaminating proteins

  • Establish appropriate controls: Include:

    • Negative controls (buffer-only, non-relevant protein)

    • Positive controls (well-characterized membrane protein)

    • Wild-type vs. mutant comparisons if performing mutation studies

  • Design treatments systematically: Create a matrix of experimental conditions varying one factor at a time (e.g., pH, salt concentration, temperature) to identify optimal conditions for protein function .

  • Determine sample size through power analysis: Calculate the required number of replicates to achieve statistical significance based on expected effect sizes from preliminary data or literature .

Remember that a good experimental design requires a strong understanding of the system you are studying . Since UPF0259 family proteins have unknown functions, preliminary characterization using bioinformatics and comparative analyses may help inform experimental design decisions.

What controls should be included when working with Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

When working with Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675, implementing proper controls is essential for experimental validity. The following comprehensive control strategy should be employed:

Experimental Controls Table:

Control TypeImplementationPurposeAnalysis Method
Negative ControlsBuffer-only samplesAccount for background signalsSubtract from experimental readings
Heat-denatured Spro_2675Control for non-specific effectsCompare activity to native protein
Empty vector expression productControl for host cell protein contaminationWestern blot, activity assays
Positive ControlsWell-characterized membrane proteinValidate experimental systemConfirm expected results with known protein
Native (non-recombinant) Spro_2675Assess recombinant protein functionalityDirect comparison of activities
Technical ControlsMulti-replicate measurementsAssess technical variabilityCalculate standard deviation
Standard curvesEnsure measurements in linear rangePlot concentration vs. response
Specificity ControlsTag-only proteinControl for tag artifactsCompare behavior to tagged protein
His-tag cleavageVerify function independent of tagPre/post cleavage comparisons

When analyzing membrane protein function, also consider including controls for detergent effects, lipid composition effects, and buffer composition effects, as these can significantly impact membrane protein behavior .

How can I optimize the expression conditions for Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Optimizing expression conditions for membrane proteins requires systematic evaluation of multiple parameters. For Spro_2675, follow this methodological approach:

  • Expression System Selection:

    • Begin with E. coli for highest yield and efficiency

    • If functional issues arise, consider yeast expression systems

    • For studies requiring post-translational modifications, evaluate insect or mammalian systems

  • Strain Optimization: Test multiple E. coli strains specialized for membrane proteins:

    • BL21(DE3)pLysS: Reduces basal expression

    • C41(DE3) and C43(DE3): Developed for toxic/membrane proteins

    • Lemo21(DE3): Allows tunable expression

  • Expression Parameters Optimization Strategy:

ParameterRecommended RangeOptimization MethodEvaluation Criteria
Induction temperature16-37°CTest 16°C, 25°C, 30°C, 37°CSoluble vs. insoluble fraction analysis
Inducer concentration0.1-1.0 mM IPTGConcentration gradientWestern blot quantification
Induction timingOD600 0.4-1.0Induce at different growth phasesYield and solubility assessment
Media compositionLB, TB, 2XYT, M9Compare different mediaTotal yield and purity analysis
AdditivesGlycerol, sucrose, betaineWith/without comparisonMembrane integration efficiency
  • Solubilization Screening: Test multiple detergents for protein extraction:

    • Mild detergents: DDM, LMNG, digitonin

    • Intermediate detergents: DM, OG

    • Harsh detergents: SDS, Triton X-100

  • Purification Optimization: Develop a purification strategy based on the His-tag:

    • IMAC purification under optimized imidazole gradient

    • Secondary purification using size exclusion chromatography

    • Consider ion exchange chromatography as a polishing step

Monitor optimization progress using SDS-PAGE, Western blotting, and functional assays to identify conditions that maximize both yield and biological activity .

What are the recommended storage and handling procedures for Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Proper storage and handling of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675 is critical for maintaining its stability and functionality. Follow these evidence-based protocols:

Long-term Storage:

  • Store lyophilized protein at -20°C or -80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • For reconstituted protein, add glycerol to a final concentration of 50% before freezing

Working Storage:

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

Handling Procedures:

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow the protein to fully dissolve by gentle mixing rather than vortexing

  • When transferring, use low-binding pipette tips to minimize protein loss

  • For experiments requiring membrane integration, reconstitute in the presence of appropriate detergents or lipids

Storage Buffer Composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

These storage and handling recommendations are specifically tailored to maintain the structural integrity and functional properties of Spro_2675 membrane protein based on experimental evidence with this protein class.

How can I assess the purity and integrity of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Assessing the purity and integrity of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675 requires a multi-method analytical approach:

Purity Assessment Methods:

Analytical TechniqueInformation ProvidedAcceptance CriteriaLimitations
SDS-PAGEMolecular weight verification, rough purity estimateSingle band at ~28 kDa (including His-tag)Limited resolution for similar-sized contaminants
Western BlotSpecific detection using anti-His antibodiesSingle specific bandQualitative rather than quantitative
Size Exclusion ChromatographyOligomeric state, aggregation assessmentSingle symmetrical peakRequires specialized equipment
Mass SpectrometryExact mass, sequence confirmationMatch to theoretical massSample preparation can be challenging
Dynamic Light ScatteringHomogeneity, aggregation stateMonodisperse populationLess sensitive for minor contaminants

Integrity Assessment Methods:

  • Circular Dichroism (CD) Spectroscopy: Evaluate secondary structure content and proper folding

  • Thermal Shift Assay: Determine protein stability through melting temperature analysis

  • Limited Proteolysis: Assess conformational integrity through digestion patterns

  • Functional Assays: Though specific function is unknown, binding assays with potential partners can indicate proper folding

For commercial preparations, purity should be greater than 90% as determined by SDS-PAGE . For research applications requiring higher purity, additional purification steps may be necessary following manufacturer recommendations.

What reconstitution procedures are recommended for lyophilized Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Proper reconstitution of lyophilized membrane proteins is critical for maintaining their structural and functional integrity. For Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675, follow this detailed stepwise procedure:

Standard Reconstitution Protocol:

  • Pre-Reconstitution Steps:

    • Equilibrate the lyophilized protein to room temperature (15-30 minutes)

    • Briefly centrifuge the vial to collect all material at the bottom

  • Basic Reconstitution:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add water gently along the sides of the vial

    • Allow to stand for 5 minutes at room temperature

    • Gently swirl or rotate until completely dissolved (avoid vortexing)

  • Storage Preparation:

    • For long-term storage, add glycerol to a final concentration of 50%

    • Aliquot into smaller volumes to avoid repeated freeze-thaw cycles

    • Flash freeze in liquid nitrogen before transferring to -20°C or -80°C

Membrane Reconstitution Protocol (for functional studies):

  • Preparation of Liposomes:

    • Create liposomes using E. coli lipid extract or defined lipid mixtures

    • Typical composition: 70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin

    • Form liposomes by extrusion through 200 nm filters

  • Protein Incorporation:

    • Solubilize protein in mild detergent (e.g., 1% DDM)

    • Mix with liposomes at protein:lipid ratio of 1:100 to 1:1000

    • Remove detergent using Bio-Beads or dialysis

    • Verify incorporation by sucrose gradient centrifugation

The reconstitution buffer should be optimized based on downstream applications, with typical starting conditions being Tris/PBS-based buffer at pH 8.0 containing 6% trehalose .

How can I identify potential binding partners or substrates of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Identifying binding partners or substrates for proteins with unknown function requires a comprehensive multi-method approach. For Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675, implement the following advanced methodological strategy:

Computational Prediction Methods:

  • Structural Homology Modeling: Generate 3D models based on related proteins with known structures

  • Molecular Docking: Screen potential binding partners in silico

  • Phylogenetic Profiling: Identify proteins with similar evolutionary patterns across species

  • Genomic Context Analysis: Examine adjacent genes in the S. proteamaculans genome for functional relationships

Experimental Identification Methods:

MethodPrincipleAdvantagesLimitationsData Analysis Approach
Pull-down AssaysImmobilize His-tagged Spro_2675 on Ni-NTA and capture interacting proteinsDirectly identifies binding partnersMay miss transient interactionsMS identification + validation
Bacterial Two-HybridUse Spro_2675 as bait in two-hybrid screeningWorks well for membrane proteinsLimited to binary interactionsStatistical analysis of positive colonies
Cross-linking Mass SpectrometryChemically cross-link proximal proteins and identify by MSCaptures in vivo interactionsComplex data analysisSpecialized cross-link search algorithms
Proximity Labeling (BioID/APEX)Fuse Spro_2675 with enzyme that labels nearby proteinsMaps protein neighborhoodsRequires genetic modificationQuantitative proteomics comparison
Lipid Overlay AssaysTest binding to immobilized lipids on membranesIdentifies lipid partnersLimited to lipid interactionsDensitometry quantification

Validation and Characterization Strategy:

  • Confirm interactions using multiple orthogonal methods

  • Perform binding affinity measurements (SPR, ITC)

  • Map interaction domains through truncation or mutation studies

  • Visualize interactions using fluorescence microscopy

  • Assess functional significance through gene knockout/complementation

This systematic approach combines computational prediction with experimental validation to comprehensively identify potential interaction partners of Spro_2675, despite its currently unknown function .

What approaches can be used to analyze the structural properties of Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Analyzing the structural properties of membrane proteins presents unique challenges due to their hydrophobic nature. For Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675, employ these advanced structural analysis methodologies:

Experimental Structural Analysis Methods:

TechniqueInformation ProvidedSample RequirementsResolution RangeSpecial Considerations
X-ray CrystallographyAtomic-level 3D structureHighly pure, homogeneous crystals1.5-3.5 ÅChallenging for membrane proteins; requires detergent screening
Cryo-Electron Microscopy3D structure in near-native statePurified protein in vitrified ice2.5-4.0 ÅBetter for larger proteins/complexes; detergent or nanodisc reconstitution
Nuclear Magnetic ResonanceSolution structure, dynamicsIsotopically labeled proteinLimited by protein sizeBetter for smaller domains; can capture dynamic information
Small-Angle X-ray ScatteringLow-resolution envelopeMonodisperse protein solution10-30 ÅProvides shape information without crystallization
Hydrogen-Deuterium Exchange MSSolvent accessibility, dynamicsPurified proteinPeptide-levelIdentifies exposed/protected regions
Circular DichroismSecondary structure contentDilute protein solutionSecondary structure levelQuick assessment of folding and stability
FTIR SpectroscopySecondary structure in membranesReconstituted proteinSecondary structure levelWorks well for membrane proteins

Computational Structure Analysis:

  • Transmembrane Domain Prediction: Use algorithms like TMHMM, Phobius, or TOPCONS

  • Ab Initio Modeling: Generate models using Rosetta membrane protocol

  • AlphaFold2/RoseTTAFold: Apply AI-based prediction specifically trained on membrane proteins

  • Molecular Dynamics Simulations: Study dynamics in explicit membrane environments

Structure-Function Analysis Strategy:

  • Generate structural model using complementary experimental and computational approaches

  • Identify conserved residues through multiple sequence alignment

  • Perform site-directed mutagenesis of key residues

  • Assess impact on stability, localization, and potential functions

  • Use crosslinking to validate predicted structural arrangements

This comprehensive structural biology approach combines multiple techniques to overcome the challenges associated with membrane protein analysis, providing insights from different resolution levels .

How can I detect and resolve contradictions in experimental data when studying Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675?

Detecting and resolving contradictions in experimental data is crucial for maintaining research integrity. For studies involving Recombinant Serratia proteamaculans UPF0259 membrane protein Spro_2675, implement this systematic contradiction detection and resolution methodology:

Contradiction Detection Framework:

  • Formalize experimental conditions as logical expressions:

    • Transform research hypotheses and experimental outcomes into formal logical statements

    • Apply a SAT Solver to identify logical inconsistencies between experimental results

    • Create a structured data dictionary to standardize terminology and measurements

  • Implement a systematic data contradiction analysis:

    • Cross-validate results across different experimental methods

    • Apply statistical tests to identify significant deviations

    • Create visualization tools (e.g., Forest plots) to compare effect sizes across experiments

Common Contradictions and Resolution Strategies Table:

Contradiction TypeExample in Spro_2675 ResearchDetection MethodResolution Strategy
Method-dependent resultsDifferent localization patterns with different detection methodsMethod cross-comparisonDetermine method-specific artifacts and limitations
Expression system artifactsDifferent functional characteristics in E. coli vs. yeast expressionSystematic comparisonIdentify system-specific post-translational modifications
Buffer/condition conflictsContradictory binding affinities in different buffersControlled variable testingIdentify buffer components affecting interactions
Batch-to-batch variationInconsistent activity between protein preparationsStatistical process controlImplement stricter quality control metrics
Literature inconsistenciesPublished data conflicts with your findingsSystematic literature reviewIdentify methodological differences explaining discrepancies

Resolution Methodology:

  • Root Cause Analysis: Systematically evaluate all variables that could contribute to contradictions

  • Decision Tree Approach: Create a structured decision process to prioritize most reliable data

  • Independent Validation: Have different researchers or laboratories replicate critical experiments

  • Metadata Analysis: Examine experimental conditions, reagent sources, and equipment calibration

  • Bayesian Integration: Weight evidence based on methodological strength and reproducibility

This approach transforms contradiction detection from an ad hoc process to a systematic methodology, significantly reducing the time required for experimental verification while increasing research reliability . When applied to membrane protein research, this framework is particularly valuable due to the inherent challenges and variability in membrane protein behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.