Recombinant Serratia proteamaculans UPF0283 membrane protein Spro_2618 (Spro_2618)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Serratia proteamaculans UPF0283 membrane protein Spro_2618, or Spro_2618, is a protein derived from the bacterium Serratia proteamaculans . Serratia proteamaculans is a Gram-negative bacterium known for its protease production and, in some instances, its invasive activity . Spro_2618 is a membrane protein that contains 353 amino acids . The function of Spro_2618 is not well-defined, but it is classified within the UPF0283 (Unknown Protein Function) family . Proteins of unknown function sometimes have structural motifs that can enable the binding of substrates or cofactors .

Structure and Characteristics

Spro_2618 is a full-length membrane protein . Membrane proteins are proteins located in or associated with the cell membrane .

  • Sequence Length: 353 amino acids

  • Source: Serratia proteamaculans (strain 568)

  • Tag: His-Tagged

  • Purity: >85% (SDS-PAGE)

  • Theoretical Molecular Weight: Approximately 39 kDa

The amino acid sequence for Spro_2618 is:
MSEPIKPRIDFEQPLEPPQEPVLRANVAFDEQQAEHFFPAAPELQQEEEEGRAEGIINAA
LKPKRSLWRKMVTAGLTLFGVSVVAQGVQWVHTAWVQQDWIAMGGGVAGGLIVFAGVGSV
VTEWRRLYRLRQRAEERDVARELLHSHGLGKGREFCEKLARQAGLDQGHPALQRWQASLH
ETQNDREVVALYAKLVQPVLDNQARREISRSAAESTLMIAVSPLAVVDMAFIAWRNIRLI
NRIAALYGIELGYFSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGI
GAGLLTARLGIKAMELCRPLPWLEGEKPKLGDFRSQLIGQLKDTMKKSDNKAK

Production

Recombinant Spro_2618 is produced using E. coli as the host organism . The protein is expressed with a His-tag, which allows for purification using affinity chromatography . After purification, the protein is typically lyophilized in a Tris/PBS-based buffer containing 6% Trehalose for stability.

Function and Role in Serratia proteamaculans

  • Membrane Protein: As a membrane protein, Spro_2618 is likely involved in interactions with the cell's external environment. It may participate in transport processes, signal transduction, or maintaining membrane integrity .

  • Involved Pathways: Spro_2618 participates in several pathways and plays different roles in them .

  • Interactions: Spro_2618 interacts directly with other proteins and molecules, as detected by methods such as yeast two-hybrid assays, co-IP, and pull-down assays .

Protein Interactions and Quaternary Structure

Protein quaternary structure refers to the arrangement of multiple folded protein subunits in a multi-subunit complex . Spro_2618 has direct interactions with other proteins and molecules, which have been detected using methods such as the yeast two-hybrid assay, co-IP, and pull-down assays . These interactions suggest that Spro_2618 may function as part of a larger protein complex . Further research is needed to elucidate the specific partners and the nature of these interactions.

Applications in Research

Recombinant Spro_2618 is used in life science research . Researchers use the recombinant protein for various purposes :

  • Antibody Production: Recombinant proteins are essential for generating antibodies specific to Spro_2618, aiding in its detection and study .

  • Protein Interaction Studies: Labeled or tagged Spro_2618 can be used in pull-down assays or co-immunoprecipitation experiments to identify interacting partners .

  • Structural Studies: The availability of recombinant Spro_2618 allows for structural determination through X-ray crystallography or NMR spectroscopy, providing insights into its function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Spro_2618; UPF0283 membrane protein Spro_2618
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Serratia proteamaculans (strain 568)
Target Names
Spro_2618
Target Protein Sequence
MSEPIKPRIDFEQPLEPPQEPVLRANVAFDEQQAEHFFPAAPELQQEEEEGRAEGIINAA LKPKRSLWRKMVTAGLTLFGVSVVAQGVQWVHTAWVQQDWIAMGGGVAGGLIVFAGVGSV VTEWRRLYRLRQRAEERDVARELLHSHGLGKGREFCEKLARQAGLDQGHPALQRWQASLH ETQNDREVVALYAKLVQPVLDNQARREISRSAAESTLMIAVSPLAVVDMAFIAWRNIRLI NRIAALYGIELGYFSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGEKPKLGDFRSQLIGQLKDTMKKSDNKAK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0283 membrane protein Spro_2618?

UPF0283 membrane protein Spro_2618 is a 353-amino acid membrane protein isolated from Serratia proteamaculans (strain 568). It belongs to the UPF0283 protein family, a group of functionally uncharacterized proteins. The protein has a UniProt identification number A8GF29 and is encoded by the Spro_2618 gene. The full-length protein contains transmembrane domains characteristic of integral membrane proteins, with probable functions in cellular processes that remain to be fully elucidated through functional studies .

What is known about the structure of Spro_2618?

The primary structure of Spro_2618 consists of 353 amino acids with the sequence beginning with MSEPIKPRID and ending with TMKKSDNKAK. Structural prediction algorithms suggest it contains multiple transmembrane helices that anchor it within the bacterial membrane. While detailed three-dimensional structural information through X-ray crystallography or cryo-EM is not yet available in the literature, hydropathy analysis indicates several hydrophobic regions consistent with a membrane-spanning protein. These structural features likely contribute to its localization and function within the bacterial membrane system .

How is recombinant Spro_2618 typically produced?

Recombinant Spro_2618 is typically produced using E. coli expression systems optimized for membrane protein production. The full-length protein (amino acids 1-353) is commonly fused to an N-terminal His-tag to facilitate purification through affinity chromatography. The expression construct contains the complete coding sequence under control of an inducible promoter. Following expression, the protein is extracted from bacterial membranes using appropriate detergents, purified via nickel affinity chromatography, and often further purified through size exclusion chromatography to ensure homogeneity. The final product is typically formulated in a stabilizing buffer containing glycerol and lyophilized for storage stability .

What are the recommended storage conditions for recombinant Spro_2618?

For optimal stability and activity maintenance, recombinant Spro_2618 should be stored at -20°C to -80°C in appropriate buffer systems. For long-term storage, the protein is best maintained as aliquots in Tris-based buffer with 50% glycerol at -80°C. Working aliquots can be stored at 4°C for up to one week without significant degradation. Repeated freeze-thaw cycles should be strictly avoided as they lead to protein denaturation and loss of functional properties. For reconstitution of lyophilized protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to 5-50% final concentration before aliquoting for storage .

How does Spro_2618 relate to bacterial volatile production and antifungal properties?

Although the direct relationship between Spro_2618 and volatile production remains to be fully characterized, Serratia proteamaculans is known to produce volatile compounds with significant antifungal properties. Research indicates that volatiles from S. proteamaculans effectively inhibit the growth of several fungi, including Rhizopus stolonifer (Mucoromycota) and Neurospora crassa (Ascomycota). Within 24 hours of exposure to S. proteamaculans volatiles, N. crassa colonies were reduced to approximately 10% of control size, while R. stolonifer colonies were limited to about 15% of control size. The volatile profiles of S. proteamaculans were found to be qualitatively similar to those of S. marcescens but exhibited quantitative differences in compound production. Further research is needed to determine if Spro_2618 plays a direct or indirect role in the biosynthesis or regulation of these bioactive volatile compounds .

What functional domains and motifs are present in Spro_2618 and how might they relate to its biological function?

Sequence analysis of Spro_2618 reveals several conserved domains and motifs characteristic of UPF0283 family proteins. The protein contains hydrophobic transmembrane segments interspersed with hydrophilic regions that likely form loops either inside or outside the cell membrane. Notably, the sequence LKPKRSLWRK (residues 56-65) contains positively charged amino acids that may be involved in protein-protein interactions or substrate binding. The region VHTAWVQQDW (residues 98-107) has a mix of hydrophobic and polar residues that could form a binding pocket. Additionally, GKGREFCEKL (residues 171-180) contains a potential redox-active cysteine that might participate in enzymatic functions. These motifs suggest potential roles in transport, signaling, or enzymatic activities, though experimental confirmation through site-directed mutagenesis and functional assays is necessary to establish their precise contributions .

How does Spro_2618 compare across different Serratia species and other related bacteria?

Comparative genomic analysis of UPF0283 family proteins reveals varying degrees of conservation across bacterial species. Homologs of Spro_2618 are found in multiple Serratia species with sequence identities ranging from 78-95%, suggesting conserved functional importance. The protein shows moderate homology (45-60% identity) with similar proteins in other Enterobacteriaceae, including Yersinia, Escherichia, and Klebsiella species. Key transmembrane domains and certain motifs exhibit higher conservation than loop regions, indicating their structural or functional significance. Phylogenetic analysis places Spro_2618 in a distinct clade with other Serratia homologs, separate from but related to similar proteins in other bacterial genera. This evolutionary conservation pattern suggests an important role in bacterial physiology that has been maintained throughout speciation events, potentially related to membrane integrity, transport functions, or adaptation to specific environmental niches .

What is the potential role of Spro_2618 in bacterial-fungal interactions?

The potential role of Spro_2618 in bacterial-fungal interactions represents an intriguing research direction. Serratia proteamaculans demonstrates significant antifungal properties through volatile compound production, inhibiting the growth of diverse fungi including R. stolonifer and N. crassa. Membrane proteins such as Spro_2618 could participate in this process through several mechanisms: (1) acting as transporters that export antifungal volatiles or their precursors; (2) functioning as sensors that detect fungal presence and trigger defensive responses; (3) participating in signaling cascades that regulate volatile biosynthesis; or (4) directly contributing to the biosynthetic machinery for volatile production. The observation that S. proteamaculans produces a distinct profile of volatile compounds compared to related bacteria suggests species-specific mechanisms involving membrane proteins like Spro_2618. Future research employing knockout studies, transcriptional analysis during bacterial-fungal interactions, and protein localization experiments would help elucidate the specific contribution of this protein to interkingdom microbial interactions .

What are the optimal conditions for expressing recombinant Spro_2618 in E. coli systems?

For optimal expression of recombinant Spro_2618 in E. coli, several critical parameters must be considered. Selection of an appropriate E. coli strain is crucial, with C41(DE3) or C43(DE3) often yielding better results for membrane proteins due to their tolerance for toxic membrane protein overexpression. The expression vector should contain the Spro_2618 gene with optimized codon usage for E. coli and a fusion tag (typically His-tag) for purification. Induction conditions significantly impact yield and quality: IPTG concentration should be limited to 0.1-0.3 mM, with induction performed at a lower temperature (16-20°C) for 16-20 hours to reduce inclusion body formation. The culture medium should be supplemented with glucose (0.2-0.5%) to repress basal expression and possibly glycerol (0.5-1%) to support membrane protein folding. Additionally, incorporation of specific chaperones (e.g., GroEL/GroES) may improve proper folding. Post-induction, gentle cell lysis using enzymatic methods combined with mild detergents (DDM or LDAO at 1-2%) is recommended to efficiently extract the protein while maintaining its native conformation .

What purification strategies are most effective for obtaining high-purity Spro_2618 protein?

A multi-step purification strategy is optimal for obtaining high-purity Spro_2618 protein suitable for structural and functional studies. The process begins with affinity chromatography using Ni-NTA resin to capture the His-tagged protein, with inclusion of 0.02-0.05% DDM or other suitable detergent in all buffers to maintain solubility. A stepwise imidazole gradient (10-500 mM) during elution helps separate the target protein from non-specific binders. Following affinity purification, ion exchange chromatography (IEX) using either cation or anion exchangers depending on the protein's calculated pI provides a second dimension of separation. Finally, size exclusion chromatography (SEC) with a Superdex 200 column removes aggregates and provides protein in a monodisperse state. For applications requiring extreme purity, an additional affinity tag (such as FLAG or Strep-tag II) can be incorporated for tandem affinity purification. Throughout the process, protein quality should be monitored via SDS-PAGE, Western blotting, and dynamic light scattering to ensure purity exceeds 90% and aggregation is minimal .

How can researchers assess the proper folding and functionality of purified Spro_2618?

Assessment of proper folding and functionality of purified Spro_2618 requires a multi-faceted approach. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, with properly folded membrane proteins typically showing characteristic spectra with minima at 208 and 222 nm indicating alpha-helical content. Thermal stability can be evaluated using differential scanning fluorimetry (DSF) with appropriate membrane protein-compatible dyes such as CPM. Intrinsic tryptophan fluorescence spectroscopy offers insights into tertiary structure integrity, with emission maxima around 330-340 nm suggesting properly folded protein. For functional assessment, liposome reconstitution followed by activity assays targeting predicted functions (transport, enzymatic activity, or binding) should be performed. Additionally, binding assays with potential ligands or interacting proteins using microscale thermophoresis (MST) or surface plasmon resonance (SPR) can confirm biological activity. Finally, limited proteolysis experiments provide information about domain organization and structural integrity, with properly folded proteins showing resistance to proteolytic digestion compared to misfolded counterparts .

What approaches can be used to study Spro_2618 membrane localization and topology?

Multiple complementary approaches can be employed to study Spro_2618 membrane localization and topology. For in vivo localization, fluorescent protein fusions (GFP or mCherry) at either terminus can be visualized using confocal microscopy to confirm membrane integration. Subcellular fractionation followed by Western blot analysis provides biochemical evidence of membrane association. For detailed topology determination, the substituted cysteine accessibility method (SCAM) is particularly effective; this involves introducing cysteine residues at predicted loop regions and assessing their accessibility to membrane-impermeable sulfhydryl reagents from either side of the membrane. Protease protection assays provide complementary information by exposing membrane preparations to proteases and identifying protected fragments through mass spectrometry. Computational prediction tools (TMHMM, Phobius) should be used initially to guide experimental design but not relied upon exclusively. For high-resolution structural information, cryo-electron microscopy of 2D crystalline arrays in lipid bilayers or detergent micelles can reveal transmembrane segment organization. These approaches together provide a comprehensive picture of how Spro_2618 is oriented within the bacterial membrane .

How might Spro_2618 contribute to bacterial antifungal mechanisms?

Spro_2618, as a membrane protein in Serratia proteamaculans, may play several potential roles in bacterial antifungal mechanisms. As demonstrated in research, S. proteamaculans produces volatile compounds that significantly inhibit fungal growth, reducing colony size of fungi like N. crassa and R. stolonifer to 10-15% of control size within 24 hours of exposure. Spro_2618 might function as a transporter facilitating the export of these antifungal volatiles or their precursors across the bacterial membrane. Alternatively, it could serve as a sensor protein that detects fungal presence through recognition of fungal metabolites or cell wall components, triggering downstream signaling pathways that upregulate production of defensive volatiles. The protein might also participate in the biosynthetic pathway of these volatiles, either directly as an enzyme or indirectly by forming complexes with biosynthetic enzymes. To determine its specific role, gene knockout studies comparing volatile profiles and antifungal activity between wild-type and Spro_2618-deficient strains would be particularly informative, as would transcriptomic analysis examining expression changes during bacterial-fungal co-culture conditions .

What experimental approaches can determine if Spro_2618 functions as a transporter?

Determining whether Spro_2618 functions as a transporter requires a systematic approach combining in vivo and in vitro methodologies. Liposome reconstitution assays represent a gold standard approach, where purified Spro_2618 is incorporated into liposomes loaded with potential substrates, followed by monitoring substrate efflux or uptake over time. Complementary to this, whole-cell transport assays comparing substrate accumulation between wild-type and Spro_2618-overexpressing or knockout strains can reveal physiologically relevant transport activity. Electrophysiological measurements using planar lipid bilayers or patch-clamp techniques can detect channel or carrier activity when the protein is exposed to potential substrates. To identify the range of possible substrates, high-throughput transport assays with fluorescent substrate analogs or radiolabeled compounds representing various metabolite classes should be conducted. Structure-function studies employing site-directed mutagenesis of conserved motifs putatively involved in substrate binding or translocation, followed by transport assays, can pinpoint critical residues. Finally, binding studies using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) with potential substrates can establish binding constants and thermodynamic parameters of interaction .

How could Spro_2618 be utilized in agricultural applications for fungal control?

The utilization of Spro_2618 in agricultural applications for fungal control presents several promising avenues based on the antifungal properties associated with Serratia proteamaculans. If Spro_2618 is confirmed to participate in antifungal volatile production or transport, it could be exploited through multiple biotechnological approaches. Engineered Serratia strains overexpressing Spro_2618 might exhibit enhanced antifungal activity against crop pathogens, serving as biological control agents when applied to soil or plant surfaces. Alternatively, if the protein directly produces or transports specific antifungal compounds, these pathways could be reconstructed in industrial microorganisms for scaled production of novel biopesticides. A systems-level understanding of how Spro_2618 integrates into bacterial antifungal mechanisms could inform the development of microbial consortia with optimized biocontrol properties. Additionally, structural insights from Spro_2618 study might guide the rational design of small-molecule fungicides mimicking its functional properties. Before field application, comprehensive testing would be required to assess effects on beneficial soil microbiota, non-target organisms, and crop health, along with evaluation of potential resistance development in target pathogens .

What protein-protein interactions might be important for Spro_2618 function?

Understanding the protein interaction network of Spro_2618 is crucial for elucidating its functional role in Serratia proteamaculans. As a membrane protein, Spro_2618 likely participates in various protein-protein interactions that mediate its biological functions. Potential interaction partners include components of transport machinery if it functions as a transporter, biosynthetic enzymes if involved in volatile compound production, or signaling proteins if it participates in sensing environmental conditions. To identify these interactions, several complementary approaches should be employed: co-immunoprecipitation followed by mass spectrometry can reveal native interaction partners in vivo; bacterial two-hybrid screening can identify direct protein-protein interactions; chemical cross-linking coupled with mass spectrometry can capture transient interactions; and proximity-dependent biotin labeling (BioID) can identify neighboring proteins in the membrane environment. Validation of identified interactions should involve co-localization studies using fluorescent tagging, bimolecular fluorescence complementation to visualize interactions in vivo, and functional assays to determine the physiological relevance of each interaction. Analysis of protein domains and motifs within Spro_2618 can further guide targeted investigation of specific interaction mechanisms .

How should researchers interpret contradictory results between in vitro and in vivo studies of Spro_2618?

When encountering contradictory results between in vitro and in vivo studies of Spro_2618, researchers should systematically evaluate several factors that might explain these discrepancies. First, examine differences in protein conformation: membrane proteins often adopt different conformations in detergent micelles (in vitro) compared to native lipid bilayers (in vivo), potentially affecting activity. Consider the lipid environment, as specific phospholipids absent in simplified in vitro systems might be essential cofactors for function in vivo. Evaluate whether post-translational modifications occurring in vivo but absent in recombinant systems affect activity. Assess if the presence or absence of interaction partners in different experimental setups influences function, particularly if Spro_2618 operates as part of a complex. Compare protein expression levels, as non-physiological overexpression in vitro may lead to aggregation or altered function compared to native expression levels. Examine differences in redox conditions, pH, ion concentrations, and other environmental parameters between systems. To resolve contradictions, consider developing more sophisticated in vitro systems that better mimic native conditions, such as proteoliposomes with native-like lipid composition, or utilize techniques like native mass spectrometry to analyze protein complexes directly extracted from membranes .

What statistical approaches are most appropriate for analyzing Spro_2618 functional data?

For robust analysis of Spro_2618 functional data, researchers should select statistical approaches appropriate to the experimental design and data characteristics. For transport or binding assays generating concentration-response curves, nonlinear regression analysis should be applied to determine parameters like Km, Vmax, or Kd values, with 95% confidence intervals reported. When comparing activity across multiple conditions or mutants, one-way ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's) is suitable, with effect sizes reported alongside p-values. For time-course experiments, repeated measures ANOVA or mixed-effects models better account for temporal correlation. Dose-response relationships should be analyzed using four-parameter logistic regression to determine EC50/IC50 values. For complex datasets with multiple variables, multivariate approaches such as principal component analysis (PCA) or partial least squares discrimination analysis (PLS-DA) can identify patterns and relationships not evident in univariate analyses. Statistical power calculations should be performed a priori to determine appropriate sample sizes, and normality and homoscedasticity assumptions should be verified before applying parametric tests. When dealing with non-normal distributions, non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) or data transformation should be considered. Finally, biological replicates (independent experiments) should be distinguished from technical replicates when reporting results .

How can researchers effectively compare their Spro_2618 findings with results from related proteins in other bacterial species?

Effective comparison of Spro_2618 findings with related proteins requires a structured approach that accounts for both sequence and functional similarities. Begin with comprehensive sequence alignment using tools like MUSCLE or Clustal Omega to establish conservation patterns across species, focusing on key functional domains and motifs. Create phylogenetic trees to visualize evolutionary relationships and identify orthologous and paralogous proteins. Standardize experimental conditions when comparing functional data across studies to minimize methodology-based variations. Develop a standardized parameter set for comparing functional metrics (e.g., transport rates, binding affinities) and normalize data to enable direct comparisons where appropriate. Create data visualization tools such as heat maps or radar plots to effectively display multi-parameter comparisons across protein homologs. Structure-function relationships should be analyzed by mapping sequence variations onto available structural models and correlating with functional differences. Collaborative databases and repositories specifically designed for UPF0283 family proteins could facilitate systematic comparison across research groups. When publishing results, explicitly discuss similarities and differences with related proteins using standardized terminology. This systematic approach enables meaningful integration of findings across species and contributes to a comprehensive understanding of this protein family's evolution and functional diversity .

What are the common pitfalls in interpreting mass spectrometry data for membrane proteins like Spro_2618?

Interpreting mass spectrometry (MS) data for membrane proteins like Spro_2618 presents several distinct challenges that researchers must navigate carefully. Hydrophobic peptides from transmembrane regions often exhibit poor solubility and ionization efficiency, leading to underrepresentation in standard proteomic analyses. This bias can result in incomplete sequence coverage and missed post-translational modifications in critical functional regions. Detergents necessary for membrane protein solubilization frequently interfere with MS analysis, causing ion suppression and reduced sensitivity; use of MS-compatible detergents (like RapiGest or ProteaseMAX) or alternative solubilization strategies is essential. The presence of lipids co-purifying with membrane proteins can form adducts that complicate mass assignment and peptide identification. When interpreting cross-linking MS data, distinguishing between specific interactions and random associations due to membrane co-localization remains challenging. For intact membrane protein MS, achieving sufficient desolvation without protein denaturation requires careful optimization of instrument parameters. Researchers should employ targeted approaches focusing on detecting specific peptides from transmembrane regions, use multiple complementary proteases beyond trypsin (which often has limited cleavage sites in hydrophobic regions), and develop specialized workflows incorporating native MS or hydrogen-deuterium exchange MS for structural information. Quantitative comparisons should account for these technical limitations and include appropriate controls specific to membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.