Recombinant SfII prophage-derived bactoprenol glucosyl transferase (gtrB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant SfII Prophage-Derived Bactoprenol Glucosyl Transferase (gtrB)

Recombinant SfII prophage-derived bactoprenol glucosyl transferase (gtrB) is an enzyme that participates in the modification of the O-antigen in Shigella flexneri. The enzyme is encoded by the gtrB gene, found within the SfII prophage genome . GtrB functions as a bactoprenol glucosyl transferase, catalyzing the transfer of glucose to bactoprenol, an essential step in the synthesis of the O-antigen .

Genetic and Biochemical Characteristics

GtrB Gene and Protein:

  • The gtrB gene is located near the integrase gene (int) and the attachment site (attP) in the SfII prophage region .

  • The protein has a molecular weight of approximately 34 kDa .

  • GtrB is a hydrophobic protein involved in the transfer of glucose residues from UDP-glucose to bactoprenol .

  • It has homologues in Escherichia coli and Salmonella bacteriophage P22, suggesting a similar evolutionary origin and function .

  • The gtrB gene is found in all S. flexneri serotypes, indicating its conserved role in O-antigen modification .

Function and Mechanism

The enzyme's function is to transfer glucose residues from UDP-glucose onto bactoprenol . GtrII then transfers the glucose onto the O-antigen repeat unit at the rhamnose III position .

Role in Serotype Conversion

Bacteriophage SfII mediates the glucosylation of Shigella flexneri O-antigen, leading to the expression of the type II antigen . GtrB is essential for this serotype conversion . Mutational analyses have shown that gtrB is required for the expression of specific O-antigen serotypes .

Applications

Recombinant GtrB is used in various research applications . These applications include:

  • Enzyme activity assays.

  • Structural studies to understand the mechanism of glycosyltransferases.

  • Creating recombinant vaccine strains .

Recombinant Protein Production

Recombinant GtrB is produced in various host organisms, including E. coli, yeast, baculovirus, or mammalian cells . The purity of the recombinant protein is generally ≥ 85%, as determined by SDS-PAGE .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gtrB; gtrBI; SF0306; S0320; SfII prophage-derived bactoprenol glucosyl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Shigella flexneri
Target Names
gtrB
Target Protein Sequence
MKISLVVPVFNEEEAIPVFYKTVREFQELKPYEVEIVFINDGSKDATESIINALAVSDPL VVPLSFTRNFGKEPALFAGLDHASGDAVIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRLKRKTAEWFYKLHNKISTPKIEENVGDFRLMSREVVENIKLLPERNLFMKGI LSWVGGQTDVVEYVRAERVAGISKFNGWKLWNLALEGITSFSTFPLRVWTYIGLFVASIS FLYGAWMIIDTLVFGNPVRGYPSLLVSILFLGGVQLIGIGVLGEYIGRIYIEVKNRPKYI IKKSHRGNP
Uniprot No.

Target Background

Function

This recombinant SfII prophage-derived bactoprenol glucosyl transferase (GtrB) is involved in O-antigen modification. It catalyzes the transfer of a glucose residue from UDP-glucose to a lipid carrier.

Database Links

KEGG: sfl:SF0306

Protein Families
Glycosyltransferase 2 family, GtrB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of bactoprenol glucosyl transferase (gtrB) in bacterial systems?

Bactoprenol glucosyl transferase (gtrB) functions as a specialized enzyme that catalyzes the transfer of glucose molecules from UDP-glucose onto undecaprenyl-pyrophosphate (UnDP) lipid carriers. This critical step is part of the O-antigen modification pathway in several bacterial species. The gtrB protein specifically mediates the attachment of the glucose moiety to the lipid carrier, which is subsequently used for O-antigen modification . The protein operates within a coordinated three-protein system where glucose transfer to the lipid carrier is the initial step in the serotype conversion process, ultimately resulting in the modification of bacterial surface antigens .

How does gtrB contribute to serotype conversion in Shigella flexneri?

In Shigella flexneri, gtrB (also referred to as bgt in some literature) plays an essential role in the serotype conversion mechanism. The lysogenic bacteriophage SfII mediates glucosylation of the S. flexneri O-antigen, resulting in the expression of the type II antigen . In this process, gtrB transfers glucose residues from UDP-glucose onto bactoprenol, which serves as an intermediate carrier. Subsequently, the specialized glucosyl transferase GtrII transfers the glucose molecule from the lipid carrier onto the O-antigen repeat unit at the rhamnose III position . This specific modification of the O-antigen structure changes the bacterial surface properties and immunological characteristics, thereby altering the serotype. Research has confirmed that both gtrB and gtrII are necessary for complete serotype conversion in S. flexneri .

What is the relationship between gtrB and other proteins in the gtr operon?

The gtr operon typically contains three genes encoding proteins that work in a coordinated manner to modify the O-antigen structure. The functional relationship between these proteins has been modeled as follows:

  • GtrB (bactoprenol glucosyltransferase): Transfers a glucose molecule from UDP-glucose onto an undecaprenyl-pyrophosphate (UnDP) lipid carrier in the inner membrane .

  • GtrA: Functions as a flippase that translocates the UnDP-glucose complex across the inner membrane of the cell wall, making it accessible to GtrC in the periplasmic space .

  • GtrC (glucosyl transferase): In the periplasm, GtrC transfers the glucose from the UnDP lipid carrier onto a specific position on the O-antigen .

This three-protein system works sequentially to achieve specific modifications of the O-antigen structure. The process is thought to occur during O-antigen synthesis, before it is attached to the lipid A core . This arrangement is conserved across different serotypes, although some exceptions exist, such as the Family II GtrC, which can function independently of GtrAB .

What are the molecular characteristics of recombinant gtrB proteins?

Recombinant gtrB proteins have been characterized with the following molecular features:

FeatureSpecificationReference
Molecular Weight34 kDa (native Bgt protein)
Protein Length305-310 amino acids (varies by source)
Expression SystemE. coli, Yeast, Baculovirus, or Mammalian Cell
Purity>90%
FormLiquid containing glycerol
Storage-20°C or -80°C for extended storage

The protein is highly conserved across different bacteriophages, with minor variations in length depending on the source organism. The native protein has been identified through [35S]-methionine labeling and T7 RNA polymerase expression systems .

In which organisms have gtrB homologues been identified?

gtrB homologues have been identified in multiple organisms, demonstrating evolutionary conservation of this enzyme across several bacterial species and their associated bacteriophages. Southern hybridization and polymerase chain reaction (PCR) analyses have revealed that bgt (gtrB) homologues exist in:

  • All Shigella flexneri serotypes

  • Escherichia coli K-12

  • Various bacteriophages, including:

    • Shigella phage SfII

    • Shigella phage SfX

    • Shigella phage SfV

    • Salmonella phage P22

The chromosomal organization of these serotype-converting genes is remarkably similar when compared across E. coli K-12, Shigella flexneri, and the P22 bacteriophage genome, suggesting similar functions and evolutionary origins .

What are the optimal experimental conditions for studying gtrB enzymatic activity in vitro?

When designing experiments to study gtrB enzymatic activity, researchers should carefully consider the following experimental parameters:

  • Buffer Composition: A buffer system maintaining pH 7.0-7.5 is typically optimal for glycosyltransferase activity, with HEPES or Tris-based buffers commonly used.

  • Cofactor Requirements: Include divalent cations such as Mg²⁺ or Mn²⁺, which often serve as cofactors for glycosyltransferases.

  • Substrate Preparation: Both UDP-glucose (donor) and bactoprenol/undecaprenyl phosphate (acceptor) must be properly prepared and solubilized, often requiring detergent micelles to maintain lipid substrate availability.

  • Temperature Control: Maintain consistent temperature (typically 30-37°C) throughout the experiment to ensure reproducibility.

  • Variable Control: Following proper experimental design principles, control all extraneous variables that might influence enzyme activity measurements .

When setting up your experimental design, adopt a systematic approach:

  • Define your variables clearly (independent variable: enzyme concentration or substrate concentration; dependent variable: rate of glucose transfer)

  • Formulate specific, testable hypotheses

  • Design appropriate controls

  • Use suitable measurement techniques (radioisotope labeling has been successfully used to detect gtrB activity)

Remember that split-plot experimental designs may be necessary when factors cannot be randomized easily, such as when testing temperature effects alongside different enzyme preparations3.

What are the recommended methods for expression and purification of recombinant gtrB for functional studies?

For optimal expression and purification of recombinant gtrB, researchers should consider the following methodological approach:

Expression Systems:

  • E. coli Expression System: Most commonly used for gtrB expression, providing high yields and relative simplicity .

  • Alternative Systems: Depending on experimental needs, yeast, baculovirus, or mammalian cell systems can be employed, especially if post-translational modifications are required .

Expression Strategy:

  • Use a vector with an appropriate promoter (T7 is effective and has been validated) .

  • Include a His-tag for efficient purification (multiple commercial preparations utilize this approach) .

  • Optimize codon usage for the expression host to improve protein yield.

Purification Protocol:

  • Cell lysis under conditions that maintain protein folding (avoid harsh detergents for this membrane-associated protein).

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins.

  • Size exclusion chromatography as a polishing step to achieve >90% purity .

  • Store purified protein in a buffer containing glycerol to maintain stability during freeze-thaw cycles .

Quality Control:

  • SDS-PAGE to confirm molecular weight (expected ~34 kDa) .

  • Western blotting if antibodies are available.

  • Activity assay to confirm functional integrity.

The table below shows commercially available recombinant gtrB proteins with their specifications:

Product NameSourceSpeciesTagProtein Length
Recombinant SfII Prophage-Derived Bactoprenol Glucosyl TransferaseE. coliShigella flexneriHisFull Length (1-309)
Recombinant Shigella Phage SfII Bactoprenol Glucosyl TransferaseE. coliShigella phage SfIIHisFull Length (1-309)
Recombinant Salmonella Phage P22 Bactoprenol Glucosyl TransferaseE. coliSalmonella phage P22HisFull Length (1-310)
Recombinant Shigella Phage SfX Bactoprenol Glucosyl TransferaseE. coliShigella phage SfXHisFull Length (1-305)
Recombinant Shigella Phage SfV Bactoprenol Glucosyl TransferaseE. coliShigella phage SfVHisFull Length (1-307)

Data compiled from commercial sources .

What are the critical challenges in designing experiments to investigate gtrB-mediated glucosylation?

Investigating gtrB-mediated glucosylation presents several methodological challenges that researchers should address through careful experimental design:

To address these challenges, researchers should:

  • Implement a systematic experimental design approach with clearly defined variables

  • Utilize appropriate controls for each experimental condition

  • Consider factorial designs to examine interaction effects between experimental factors

  • Apply appropriate statistical methods for data analysis that account for the experimental structure used3

How does substrate specificity vary among gtrB proteins from different bacteriophage sources?

Substrate specificity variation among gtrB proteins from different bacteriophage sources represents an important area of research with implications for understanding serotype conversion mechanisms. Current evidence suggests both conservation and divergence in substrate specificity:

  • Functional Conservation: Despite sequence variations, gtrB proteins from different sources (SfII, SfX, SfV, P22) appear to perform the same basic function—transferring glucose from UDP-glucose to the lipid carrier .

  • Structural Variations: The slight differences in protein length (ranging from 305-310 amino acids) among gtrB variants from different bacteriophages may influence substrate binding sites and catalytic efficiency .

  • Cross-Functionality: Studies have shown that the bgt (gtrB) gene from SfII can work with the gtrX gene from bacteriophage SfX, indicating functional interchangeability between some gtrB variants .

To properly investigate substrate specificity differences, researchers should:

  • Perform comparative enzymatic assays using purified gtrB proteins from different bacteriophage sources with standardized substrates.

  • Analyze kinetic parameters (Km, Vmax) to quantify differences in substrate affinity and catalytic efficiency.

  • Conduct site-directed mutagenesis of conserved residues to identify those critical for substrate recognition versus catalytic activity.

  • Consider structural biology approaches such as X-ray crystallography or cryo-EM to determine structural differences that may explain functional variations.

  • Use split-plot experimental designs when comparing multiple enzyme variants under different conditions, ensuring proper statistical analysis of the results3.

What methodological approaches are recommended for investigating interactions between gtrB and other components of the serotype conversion system?

To effectively investigate interactions between gtrB and other components of the serotype conversion system (particularly GtrA and GtrC), researchers should employ several complementary methodological approaches:

When investigating these complex interactions, researchers should follow the systematic experimental design principles outlined in the literature, clearly defining variables, formulating testable hypotheses, and implementing appropriate controls for each experiment .

How can researchers troubleshoot contradictory results when studying gtrB function?

When faced with contradictory results in gtrB function studies, researchers should implement a systematic troubleshooting approach:

  • Review Experimental Design Structure:

    • Evaluate whether your experimental design adequately accounts for all variables

    • Consider whether a split-plot or other complex design structure might better accommodate your experimental constraints

    • Ensure that your statistical analysis matches your experimental design structure to avoid incorrect interpretations3

  • Examine Protein Quality and Activity:

    • Verify protein integrity through SDS-PAGE and Western blotting

    • Check for protein aggregation or degradation that may affect activity

    • Perform activity assays under standardized conditions to ensure enzyme functionality

    • Remember that even in validated expression systems, some related proteins (like GtrII) have proven difficult to detect despite predicted expression

  • Validate Substrate Quality:

    • Ensure UDP-glucose purity and activity

    • Verify the integrity of the lipid substrate (undecaprenyl-pyrophosphate)

    • Control for potential interfering substances in reaction mixtures

  • Consider Environmental Variables:

    • Systematically test different buffer compositions, pH levels, and ionic strengths

    • Evaluate temperature effects on protein stability and activity

    • Examine the influence of detergents and lipid composition on enzyme function

  • Implement Methodological Controls:

    • Include positive controls with confirmed activity

    • Use negative controls lacking essential components

    • Run parallel experiments with related enzymes (e.g., gtrB from different bacteriophages) for comparison

  • Statistical Approach to Resolving Discrepancies:

    • Apply appropriate statistical methods based on your experimental design

    • Consider increasing replication to improve statistical power

    • Evaluate whether outliers are due to technical errors or represent biologically meaningful variation

    • Remember that proper randomization and blocking in your experimental design are essential for valid statistical analysis

When reporting contradictory results, clearly document all experimental conditions, present all data transparently, and discuss possible explanations for the observed discrepancies. This approach not only helps resolve the immediate contradiction but also contributes valuable information to the field.

What are the current advanced techniques for quantifying and characterizing the glucosylation activity of gtrB?

Advanced techniques for quantifying and characterizing gtrB glucosylation activity employ a combination of biochemical, biophysical, and analytical approaches:

For optimal results, researchers should employ multiple complementary techniques and carefully design experiments following established methodological guidelines for enzyme characterization.

How might research on gtrB contribute to understanding bacterial pathogenesis and host-pathogen interactions?

Research on gtrB has significant potential to advance our understanding of bacterial pathogenesis through several key mechanisms:

  • Serotype Conversion and Immune Evasion: The gtrB protein plays a crucial role in O-antigen modification, which directly impacts bacterial serotype . Further research could illuminate how these modifications help pathogens like Shigella flexneri evade host immune responses through altered surface antigen presentation.

  • Phage-Mediated Virulence Acquisition: The presence of gtrB in bacteriophages like SfII, SfX, and SfV suggests a mechanism for horizontal transfer of virulence determinants . Research on gtrB could provide insights into how lysogenic conversion contributes to the emergence of new pathogenic variants.

  • Evolutionary Relationships: The similar chromosomal organization of serotype-converting genes across E. coli, Shigella, and Salmonella bacteriophage P22 indicates common evolutionary origins . Studying gtrB could help trace the evolutionary history of these important virulence determinants.

  • Novel Therapeutic Targets: Understanding the precise mechanism of gtrB-mediated glucosylation could identify potential targets for therapeutic intervention that could disrupt serotype conversion and potentially reduce bacterial virulence.

To advance these research directions, investigators should:

  • Implement well-designed experiments following systematic principles of experimental design

  • Consider the complex interactions between multiple factors using appropriate experimental structures, such as split-plot designs when necessary3

  • Utilize multiple complementary techniques to build a comprehensive understanding of gtrB's role in pathogenesis

As research progresses, integrating findings about gtrB into broader models of bacterial pathogenesis will provide valuable insights for developing new approaches to combat bacterial infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.