Recombinant Sheep Acyl-CoA desaturase (SCD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sheep Acyl-CoA Desaturase (SCD)

Recombinant Sheep Acyl-CoA Desaturase (SCD) is a genetically engineered enzyme produced to study lipid metabolism and monounsaturated fatty acid biosynthesis in ovine systems. SCD catalyzes the Δ9-cis desaturation of saturated fatty acyl-CoAs, converting stearoyl-CoA (C18:0) and palmitoyl-CoA (C16:0) into oleoyl-CoA (C18:1) and palmitoleoyl-CoA (C16:1), respectively . This enzyme is critical for cellular membrane fluidity, lipid storage, and metabolic regulation . Recombinant versions enable precise biochemical characterization and functional studies.

Gene and Protein Structure

  • Gene: The ovine SCD gene spans 3,989 bp, with a conserved coding sequence (CDS) of 1,080 bp across Bovidae species . No polymorphisms were detected in the coding region, indicating high evolutionary conservation .

  • Protein: The recombinant enzyme is a 359-amino acid protein (37–40 kDa) with:

    • Four transmembrane domains .

    • A Δ9-fatty acid desaturase (Delta9-FADS) domain responsible for catalytic activity .

    • A hydrophilic structure lacking a signal peptide .

Table 1: Key Features of Recombinant Sheep SCD

PropertyDetail
Host SystemEscherichia coli (E. coli)
TagPolyhistidine (His-tag) at N-terminus
Protein LengthFull-length mature protein (residues 2–359)
Post-Translational ModificationsNone (prokaryotic expression lacks mammalian glycosylation)

Cloning and Expression

  • The sheep SCD CDS is cloned into bacterial vectors (e.g., pET-28a) under T7/lac promoters .

  • Expressed in E. coli BL21(DE3) cells, induced by IPTG .

  • Solubility: Predominantly forms inclusion bodies, requiring denaturation (urea) and refolding for activity .

Purification

  • Affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resin binds the His-tag .

  • Purity: >90% as confirmed by SDS-PAGE .

Enzyme Activity

  • Substrates: Stearoyl-CoA (Km = 12.5 μM) and palmitoyl-CoA (Km = 8.7 μM) .

  • Cofactors: Requires NADH, cytochrome b5 reductase, and cytochrome b5 for electron transfer .

  • Optimal Conditions: pH 7.4, 37°C, with activity enhanced by lipid chaperones .

Metabolic Roles

  • Lipogenesis: Supplies oleate for triglyceride and phospholipid synthesis .

  • Regulation: Downregulates fatty acid oxidation genes (e.g., CPT1) and upregulates lipogenic genes (e.g., FASN, ACACA) in ovine models .

Table 2: Functional Pathways Involving Sheep SCD

PathwayAssociated Proteins/GenesRole of SCD
Fatty Acid BiosynthesisACACA, FASN, DGAT1Enhances MUFA production
PPAR SignalingPPARG, SREBF1Modulates lipid storage
AMPK SignalingPRKAA1, HMGCRLinks energy status to lipid metabolism

In Vitro Studies

  • Overexpression: Increases intracellular triglyceride content by 40% in sheep granulosa cells .

  • Knockdown: Reduces C18:1 levels by 60%, impairing lipid droplet formation .

Genetic and Metabolic Markers

  • Polymorphisms: Four SNPs identified in non-coding regions (promoter, introns) of the ovine SCD gene .

    • SCD01 (promoter): Linked to fat-tail development in sheep breeds .

  • Biomarkers: Cholesterol and pantothenate levels correlate with SCD activity in lipidomic assays .

Comparative Analysis Across Species

SpeciesSCD IsoformsKey Expression SiteFunctional Divergence
SheepSCD1Mammary gland, liver Regulates milk fat synthesis
CattleSCD1, SCD5Mammary gland Influences C16:1/C18:1 ratios
HumanSCD1, SCD2Liver, brain Associates with obesity

Challenges and Future Directions

  • Limitations: Low solubility of recombinant SCD in prokaryotic systems necessitates refolding .

  • Applications:

    • Engineering SCD-knockout sheep for metabolic disease models .

    • Enhancing MUFA content in dairy products via transgenic approaches .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific format requirements. If so, please indicate your preferences when placing the order, and we will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20℃/-80℃. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development if possible.
Synonyms
SCD; Acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase; Stearoyl-CoA desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-359
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
SCD
Target Protein Sequence
PAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPNYQD KEGPKPKLEYVWRNIILMGLLHLGALYGITLIPTCKIYTFLWVLFYYVISALGITAGVHR LWSHRTYKARLPLRVFLIIANTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVREKGATLDLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGES FQNSLFFATFLRYAVVLNATWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAVLGRMKRTGEESYKSG
Uniprot No.

Target Background

Function
Stearoyl-CoA desaturase is an enzyme that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. It catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates, including palmitoyl-CoA and stearoyl-CoA. This process results in a mixture of 16:1 and 18:1 unsaturated fatty acids. Stearoyl-CoA desaturase plays a vital role in lipid biosynthesis and regulates the expression of genes involved in lipogenesis and mitochondrial fatty acid oxidation. It also plays a significant role in body energy homeostasis and contributes to the biosynthesis of membrane phospholipids, cholesterol esters, and triglycerides.
Gene References Into Functions
  1. Co-dosing lowered the mRNA abundance of SCD1 in the mammary secretory tissue (33%), while no changes were detected in the SCD5 isoform or in the studied transcription factors (SREBF1, PPARG, SP1, and EGR2). PMID: 25547303
  2. The study identified polymorphisms in the stearoyl-coenzyme A-desaturase gene in 458 lambs representing three traditional Iranian sheep breeds: fat-tailed, medium fat-tailed, and thin-tailed. PMID: 24271826
  3. This research focused on stearoyl-CoA desaturase. PMID: 20059933
Database Links

KEGG: oas:443185

UniGene: Oar.610

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic molecular structure of sheep Stearoyl-CoA desaturase?

Sheep SCD is a 359 amino acid protein with a molecular weight of approximately 41.67 kDa and an isoelectric point of 9.24. The protein has an instability index of 44.83 (classifying it as stable) and an aliphatic index of 87.21, indicating relatively high thermostability. The protein contains 33 negatively charged residues (Asp + Glu) and 42 positively charged residues (Arg + Lys), with a Grand Average of Hydropathicity (GRAVY) value of -0.20, suggesting moderate hydrophilicity . Structurally, sheep SCD contains conserved histidine motifs that coordinate iron atoms essential for desaturase activity, similar to the SCD proteins of other mammalian species.

How conserved is the SCD gene sequence across sheep breeds compared to other species?

The SCD gene shows high conservation in the coding region across sheep breeds, with no polymorphisms identified within the 1080 bp coding sequence in a study examining 85 animals from eight different sheep breeds . Comparing sheep SCD to other species, the amino acid sequence shows high similarity within the Bovidae family (94.2% to 99.7% identity). Specifically, sheep SCD shows approximately 97.5% similarity with cattle SCD and 98.1% similarity with yak and bison SCD . This high degree of conservation in the coding region suggests the critical functional importance of the SCD protein across ruminant species.

What are the common methods for isolating and expressing recombinant sheep SCD?

For isolation and expression of recombinant sheep SCD, researchers typically employ the following methodological approach:

  • RNA extraction from sheep adipose tissue or mammary gland using TRIzol reagent or commercial kits

  • cDNA synthesis using reverse transcriptase and oligo(dT) primers

  • PCR amplification of the full-length SCD coding sequence using gene-specific primers

  • Cloning of the amplified sequence into an expression vector (commonly pET, pGEX, or pBAD systems)

  • Transformation into a suitable expression host (typically E. coli BL21(DE3) or similar strains)

  • Induction of expression using IPTG or other inducers

  • Protein purification via affinity chromatography, taking advantage of fusion tags

  • Verification of recombinant protein via SDS-PAGE and Western blotting

The expression of functional SCD often requires careful optimization of culture conditions including temperature, induction timing, and host cell selection to minimize formation of inclusion bodies due to the membrane-associated nature of the native protein.

What genetic variations have been identified in sheep SCD, and what regions show polymorphism?

While the coding region of the sheep SCD gene appears highly conserved, genetic variation has been identified in non-coding regions. A comprehensive analysis of 3989 bp of the ovine SCD gene revealed four SNPs located in regulatory regions: one in the promoter region (SCD01) and three in intronic regions (SCD02 and SCD03 in intron 2, and SCD04 in intron 3) . The promoter SNP (SCD01) showed the highest level of polymorphism among the studied breeds, with intermediate frequencies in specialized breeds and lower variability in meat-focused populations. These non-coding variants may influence gene expression and regulation, potentially affecting SCD activity and downstream lipid metabolism traits.

How does the expression profile of SCD differ across tissues in sheep, and how is this affected by physiological conditions?

SCD expression in sheep demonstrates tissue-specific patterns and is significantly influenced by physiological states such as pregnancy and nutritional status. While comprehensive tissue expression data for sheep is limited in the provided search results, research in ruminants generally shows that SCD is highly expressed in adipose tissue, mammary gland during lactation, and liver.

During pregnancy and under feed deprivation conditions, SCD expression patterns change dramatically, reflecting metabolic adaptation. A study on pregnant Barki sheep under complete feed deprivation examined the gene expression patterns of lipid metabolism markers including SCD . These expression changes are part of the metabolic adaptation mechanisms that allow pregnant sheep to mobilize fat reserves and maintain essential physiological functions during nutritional stress. Researchers investigating tissue-specific expression should use quantitative PCR with tissue-specific reference genes for normalization, and consider the physiological state of the animals when interpreting results.

What is the relationship between sheep SCD genetic variants and fatty acid composition in milk and meat?

The relationship between SCD genetic variants and fatty acid composition is complex and of significant interest for livestock improvement. While no polymorphisms were found in the coding region of sheep SCD, the regulatory SNPs (particularly SCD01 in the promoter region) may influence SCD expression levels and subsequently affect fatty acid desaturation capacity .

Research has identified multiple milk fatty acid-related QTL exclusively enriched for adaptive selective sweeps, including those associated with linoleic acid, lauric acid, conjugated linoleic acid, capric acid, cis-10 heptadecenoic acid, pentadecylic acid, palmitic acid, and palmitoleic acid . Many of these fatty acids are influenced by SCD activity, suggesting that selection for adaptive traits has influenced milk fatty acid composition in sheep. The methodological approach to studying these relationships typically involves genotyping for SCD variants, quantifying fatty acid profiles through gas chromatography, and performing association analyses while accounting for other genetic and environmental factors.

How does recombinant sheep SCD enzyme activity differ from native SCD, and what factors influence its catalytic properties?

When comparing recombinant and native sheep SCD, several factors can influence enzyme activity and catalytic properties:

  • Post-translational modifications: Native SCD undergoes specific modifications that may be absent or different in recombinant systems

  • Membrane association: Native SCD is an integral membrane protein of the endoplasmic reticulum, and this microenvironment is difficult to replicate in recombinant systems

  • Protein folding: Expression in heterologous systems may result in subtle differences in protein folding

  • Cofactor availability: The activity of SCD depends on iron availability and electron transport components

Methodologically, researchers should assess enzyme kinetics (Km, Vmax) using various substrates (typically palmitoyl-CoA and stearoyl-CoA) and compare product profiles (palmitoleic and oleic acids) between recombinant and native forms. Assay conditions including pH, temperature, and cofactor concentrations should be systematically optimized. Additionally, circular dichroism spectroscopy can be employed to compare secondary structure elements between native and recombinant forms.

What are the optimal conditions for assaying recombinant sheep SCD activity in vitro?

For optimal in vitro assay of recombinant sheep SCD activity, researchers should consider the following methodological approach:

  • Buffer composition: Typically phosphate buffer (pH 7.2-7.4) containing EDTA to control metal ion concentrations

  • Substrate preparation: Prepare stearoyl-CoA or palmitoyl-CoA substrates in detergent micelles or incorporated into phospholipid vesicles

  • Cofactor requirements: Include NADH or NADPH, cytochrome b5, and cytochrome b5 reductase in the reaction mixture

  • Reaction conditions: Maintain temperature at 37°C with gentle mixing

  • Oxygen availability: Ensure adequate oxygenation without excessive oxidative stress

  • Detection methods: Monitor substrate depletion or product formation via:

    • Gas chromatography of fatty acid methyl esters

    • HPLC analysis of CoA derivatives

    • Radiometric assays using 14C-labeled substrates

  • Data analysis: Calculate enzymatic activity as nmol of substrate converted per minute per mg of protein

The choice between detergent-solubilized enzyme and membrane-incorporated preparations depends on the specific research question, with the latter providing a more physiologically relevant environment but with additional technical challenges.

How can one effectively design primers for cloning full-length sheep SCD for recombinant expression?

Designing effective primers for cloning full-length sheep SCD requires careful consideration of several factors:

  • Sequence verification: Base primers on verified sheep SCD sequences (GenBank accession numbers or published literature)

  • Full coding sequence coverage: Design primers to amplify the complete 1080 bp coding sequence

  • Addition of restriction sites: Incorporate restriction enzyme sites compatible with the destination vector

  • Kozak sequence: Include an optimal Kozak consensus sequence (GCCACC) before the start codon for efficient translation

  • Fusion tags: Consider incorporating sequences for fusion tags (His, GST, etc.) for purification

  • Codon optimization: If necessary, optimize codons for the expression host

  • Primer properties:

    • Length: 25-35 nucleotides (excluding restriction sites)

    • GC content: 40-60%

    • Tm: 58-65°C with minimal difference between forward and reverse primers

    • Avoid secondary structures and primer-dimers

A typical primer set might look like:
Forward: 5'-NNNNGGATCCGCCACCATGTCCGACCTGAAGGCGCAGAAG-3' (includes BamHI site)
Reverse: 5'-NNNNAAGCTTTCAGCTCTTGTGGCTGAGGGTTT-3' (includes HindIII site)

What strategies can be employed to overcome expression challenges for sheep SCD in bacterial systems?

Expressing sheep SCD in bacterial systems presents several challenges due to its membrane-associated nature. Effective strategies include:

  • Solubility enhancement:

    • Use solubility-enhancing fusion partners (SUMO, thioredoxin, or MBP)

    • Co-express with molecular chaperones (GroEL/GroES)

    • Express truncated forms excluding transmembrane domains

  • Expression conditions optimization:

    • Lower temperature (16-20°C) during induction phase

    • Reduced inducer concentration (0.1-0.5 mM IPTG)

    • Extended expression time (16-24 hours)

  • Host strain selection:

    • Use strains with enhanced membrane protein expression capabilities (C41(DE3), C43(DE3))

    • Consider strains with modified oxidizing environments

  • Alternative expression systems:

    • Baculovirus-insect cell systems for improved folding

    • Cell-free expression systems with added microsomal membranes

  • Refolding strategies:

    • Isolate inclusion bodies and refold using detergent gradients

    • Employ artificial chaperones to assist refolding

Each approach requires systematic optimization, with expression outcomes evaluated via SDS-PAGE, Western blotting, and enzymatic activity assays.

How does sheep SCD compare structurally and functionally to SCD from other ruminant species?

Sheep SCD shows high structural and functional similarity to other ruminant SCDs, with some distinct characteristics. Comparative analysis reveals:

SpeciesAmino Acid Similarity to Sheep SCDKey Structural Differences
Cattle97.5%Minor differences in hydropathicity (-0.23 vs -0.20)
GoatVery high (>95%)Similar aliphatic index (87.49 vs 87.21)
Buffalo98.1%Slight difference in molecular weight (41.70 vs 41.67 kDa)
Yak98.1%Similar isoelectric point (9.22 vs 9.24)

All ruminant SCDs maintain the conserved histidine-containing motifs essential for catalytic activity. The high conservation of structural properties including molecular weight (approximately 41.5-41.7 kDa), isoelectric point (9.19-9.24), and moderate hydropathicity (-0.17 to -0.23) suggests similar functional properties across ruminant species .

When interpreting cross-species comparisons, researchers should consider that minor amino acid differences may impact substrate specificity, regulatory mechanisms, or protein-protein interactions, potentially explaining species-specific differences in fatty acid profiles.

What is the relationship between SCD gene expression and adaptive traits in different sheep breeds?

SCD gene expression appears to be intricately connected with adaptive traits in sheep breeds. Analysis of selective sweeps across the sheep genome identified SCD among genes showing adaptation-related selective sweeps (adapCSS). These genetic signatures indicate selection for traits that enhance survival in specific environments .

The relationship between SCD and adaptation is multifaceted:

  • Thermal adaptation: SCD is associated with adaptive thermogenesis, allowing sheep to adjust their metabolism to temperature variations

  • Fat metabolism adaptation: Studies have identified enriched GO terms associated with lipid metabolism in genes harboring adapCSS, including SCD. This suggests selection pressure on fat metabolism pathways as sheep adapted to diverse environments and feed resources

  • Breed-specific adaptations: Different sheep breeds show varying frequency of SCD promoter region polymorphisms (SCD01), suggesting differentiated selection pressure. Specialized breeds showed intermediate frequencies of this polymorphism, while meat populations showed lower variability

  • Nutritional stress response: Expression patterns of SCD in pregnant Barki sheep under feed deprivation illustrate the gene's role in metabolic adaptation to nutritional challenges

When investigating these relationships, researchers should employ an integrated approach combining genomic (selective sweep analysis), transcriptomic (expression profiling), and phenotypic data across diverse sheep breeds from different environmental conditions.

How do polymorphisms in sheep SCD regulatory regions influence gene expression and phenotypic traits?

While the coding region of sheep SCD is highly conserved, polymorphisms in regulatory regions (particularly the promoter SNP SCD01) may significantly influence gene expression and downstream phenotypic traits . The mechanisms and effects include:

  • Transcriptional regulation: Promoter SNPs may alter binding sites for transcription factors, affecting basal expression levels and responsiveness to regulatory signals like hormones and nutritional factors

  • Breed-specific patterns: The promoter SNP (SCD01) shows differential frequency patterns between specialized breeds and meat-focused populations, suggesting functional relevance to production traits

  • Association with QTL regions: SCD is associated with quantitative trait loci for multiple fatty acid compositions in milk, including linoleic acid, lauric acid, conjugated linoleic acid, and others

  • Adaptive significance: The presence of SCD in genomic regions showing signatures of selection (selective sweeps) for adaptation suggests these regulatory variants have functional consequences for fitness in different environments

To investigate these relationships, researchers should employ:

  • Luciferase reporter assays to directly measure the impact of promoter variants on gene expression

  • Electrophoretic mobility shift assays to identify differential transcription factor binding

  • ChIP-seq to map regulatory element interactions in vivo

  • Association studies linking regulatory variants to production traits

  • Environmental challenge studies to assess genotype-by-environment interactions

What are the implications of sheep SCD research for developing more climate-resilient sheep breeds?

Research on sheep SCD has significant implications for developing climate-resilient sheep breeds through several mechanisms:

  • Thermal adaptation: SCD's role in adaptive thermogenesis could be harnessed to breed sheep with enhanced temperature regulation capabilities . This is particularly relevant as climate change brings more frequent temperature extremes.

  • Feed efficiency: Understanding SCD's role in lipid metabolism during nutritional stress could help develop breeds with improved feed conversion efficiency during drought or feed scarcity conditions .

  • Disease resistance: The connection between lipid metabolism genes (including SCD) and parasite resistance-related enriched QTL suggests potential applications in breeding for enhanced disease resilience. Genes associated with lipid droplet formation, including those in SCD pathways, play important roles in host-pathogen interactions .

  • Genomic selection approaches: Identification of SCD variants in adaptive selective sweeps provides potential markers for genomic selection programs targeting climate resilience traits.

Methodologically, research in this area should combine:

  • Genotyping for SCD variants across diverse breeds adapted to different climates

  • Challenge studies under controlled environmental stressors

  • Field trials in different agro-ecological zones

  • Multi-omics approaches integrating genomic, transcriptomic, and metabolomic data

How can CRISPR-Cas9 technology be applied to study sheep SCD function and regulation?

CRISPR-Cas9 technology offers powerful approaches for studying sheep SCD function and regulation:

  • Functional characterization through gene editing:

    • Complete knockout of SCD to assess essential functions

    • Introduction of specific coding variants to study structure-function relationships

    • Creation of reporter constructs (e.g., SCD-GFP fusions) to monitor expression and localization

  • Regulatory element analysis:

    • Targeted modification of promoter elements, including the polymorphic SCD01 site

    • Deletion or mutation of putative enhancer elements

    • Introduction of regulatory variants identified in adaptation-associated selective sweeps

  • Methodological considerations:

    • Design of efficient sgRNAs targeting specific SCD regions

    • Delivery methods (microinjection into zygotes vs. somatic cell nuclear transfer)

    • Off-target effect prediction and validation

    • Phenotypic characterization pipelines (transcriptomic, proteomic, metabolomic)

    • Cell models vs. animal models (primary sheep cells vs. whole organism)

  • Practical applications:

    • Creation of isogenic cell lines differing only in SCD variants

    • Development of sheep models with modified SCD function for studying metabolic disorders

    • Potential future breeding applications through precise introduction of beneficial variants

CRISPR experiments should incorporate comprehensive controls and multiplexed readouts to fully characterize the complex effects of SCD modifications on lipid metabolism and related physiological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.