Recombinant Sheep Adenosine receptor A3 (ADORA3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Characteristics

The sheep ADORA3 gene encodes a 317-amino acid protein with seven transmembrane domains, characteristic of GPCRs . Key features include:

  • Sequence Identity: Sheep ADORA3 shares 85% sequence identity with the human homolog, higher than rodent counterparts (72–73% identity with human) .

  • Tissue Distribution: In sheep, ADORA3 mRNA is most abundant in the lung, spleen, and pineal gland, with moderate expression in the brain, kidney, and testis .

  • Ligand Binding: The recombinant protein binds agonists like N<sup>6</sup>-aminoiodobenzyladenosine with high affinity (K<sub>d</sub> ≈ 6 nM) and demonstrates preferential binding to xanthines with acidic para-substituents (e.g., BW-A1433) .

Table 1: Species Comparison of ADORA3 Sequence Identity

Species% Identity with Human ADORA3
Sheep85
Rat72
Mouse73
Rhesus Monkey97

Production and Purification

Recombinant sheep ADORA3 is typically produced in E. coli or mammalian expression systems. Specifications include :

  • Expression System: E. coli (full-length protein with N-terminal His tag).

  • Purity: >90% (verified by SDS-PAGE).

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0).

  • Reconstitution: Soluble in deionized water, often stabilized with 50% glycerol for long-term storage.

Pharmacological Profile

Recombinant sheep ADORA3 exhibits distinct ligand-binding properties and signaling pathways:

  • Agonists:

    • 2-Cl-IB-MECA (EC<sub>50</sub> = 11 nM) .

    • CF-101 (IB-MECA), a clinical candidate for inflammatory diseases .

  • Antagonists:

    • BW-A1433 (K<sub>i</sub> = 23.5 µM) .

    • MRS-1523 (K<sub>i</sub> = 18.9 nM) .

  • Signaling Pathways:

    • Inhibits adenylyl cyclase via G<sub>i</sub>/G<sub>o</sub> proteins, reducing cAMP levels .

    • Activates phospholipase C (PLC), increasing intracellular Ca<sup>2+</sup> and inositol trisphosphate .

Cardioprotection Studies

  • Recombinant sheep ADORA3 is used to investigate sustained cardioprotection during ischemia. Activation in ventricular cells reduces injury from subsequent ischemic events .

  • In transfected atrial cells, ADORA3 expression extends the duration of cardioprotection .

Inflammation and Cancer

  • ADORA3 overexpression in inflammatory and cancer cells makes it a biomarker and therapeutic target .

  • Agonists like CF-102 show anti-proliferative effects in preclinical cancer models .

Species-Specific Drug Development

  • The sheep receptor’s high homology to human ADORA3 (~85%) makes it a valuable model for translational studies .

  • Differences in ligand selectivity (e.g., sheep vs. rodent ADORA3) highlight the need for species-specific drug screening .

Clinical and Preclinical Relevance

  • Therapeutic Candidates:

    • CF-101 (Phase III trials for rheumatoid arthritis) .

    • AST-004, a brain-penetrant agonist for neuroprotection .

  • Challenges: Species-dependent effects complicate rodent-to-human extrapolation. For example, A3AR activation is cardioprotective in humans but exacerbates injury in mice .

Future Directions

  • Biased Agonism: Developing ligands that selectively activate cardioprotective pathways (e.g., MAPK/ERK) over pro-inflammatory responses .

  • Structural Studies: Cryo-EM and X-ray crystallography to resolve activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ADORA3; Adenosine receptor A3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MPVNSTAVSWTSVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVISLGVTIHFYSCLFMTCLMLIFTHASIMSLLAIAVDRYLRVKLTVRYRR VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADENLTFLPCRFRSVMRMDYMVYFS FFLWILVPLVVMCAIYFDIFYIIRNRLSQSFSGSRETGAFYGREFKTAKSLLLVLFLFAL CWLPLSIINCILYFDGQVPQTVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV MCQPSKSMDPSTEQTSE
Uniprot No.

Target Background

Function
Adenosine receptor A3 (ADORA3) is a G protein-coupled receptor that inhibits adenylyl cyclase.
Database Links

KEGG: oas:443330

UniGene: Oar.514

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Most abundant in lung, spleen and pineal gland. Moderate expression in brain, kidney and testis.

Q&A

What is the molecular structure of recombinant sheep ADORA3?

The protein's molecular architecture includes characteristic regions for G protein coupling and ligand binding, with specific domains that contribute to its pharmacological profile. Unlike the rat homolog, sheep ADORA3 exhibits notable structural features that allow for differential binding of xanthine-based antagonists, particularly those with acidic side chains .

How does the tissue distribution of sheep ADORA3 compare with other species?

The tissue distribution profile of sheep ADORA3 shows significant differences compared to other species, particularly the rat. In sheep, ADORA3 mRNA transcript is most abundant in lung, spleen, and pineal gland, with moderate levels present in brain, kidney, and testis . This distribution pattern contrasts markedly with the rat, where A3 receptor expression is primarily restricted to the testis .

Interestingly, the widespread expression profile of sheep ADORA3 more closely resembles the human pattern than the rat pattern. For instance, both sheep and human ADORA3 show significant expression in lung tissue . This observation has important implications for using sheep as a model for human adenosine receptor studies, suggesting that physiological roles of ADORA3 may be more conserved between sheep and humans than between rats and humans.

What are the basic pharmacological characteristics that distinguish sheep ADORA3?

Sheep ADORA3 displays distinctive pharmacological properties that clearly differentiate it from other adenosine receptor subtypes (A1, A2A, A2B) and from A3 receptors in other species. The receptor demonstrates high affinity binding to the radioligand N6-amino[125I]iodobenzyladenosine with a Kd of approximately 6 nM .

The agonist potency order for sheep ADORA3 is:

  • N6-aminoiodobenzyladenosine > N-ethylcarboxamidoadenosine ≥ (R)-phenylisopropyladenosine >> cyclopentyladenosine

For antagonists, the potency order is:

  • I-ABOPX (Ki = 3 nM) > BW-A1433 > 1,3-dipropyl-8-sulfophenylxanthine = xanthine amine cogener >> 8-cyclopentyl-1,3-dipropylxanthine

A distinctive characteristic of sheep ADORA3 is its ability to bind 8-phenylxanthines with acidic para-substituents with higher affinity than those with basic substituents. This differs from both A1 adenosine receptors and A3 receptors from certain other species .

What are the optimal expression systems for recombinant sheep ADORA3?

Based on published research, several expression systems have proven effective for recombinant sheep ADORA3, with mammalian cell lines showing particular success:

  • CHO K1 cells: Chinese hamster ovary cells have been successfully used for stable transfection of sheep ADORA3, allowing for functional receptor expression with appropriate pharmacological properties . This system is particularly useful for cAMP signaling studies, as the receptor couples to inhibition of adenylyl cyclase in these cells.

  • HEK-293 cells: Human embryonic kidney cells provide another viable platform for sheep ADORA3 expression. The methodology typically involves:

    • Subcloning the ADORA3 cDNA into appropriate expression vectors (e.g., CLDN10B)

    • Transfection using Lipofectin or similar reagents

    • Selection of stable transfectants using G418 (0.5 μg/ml)

    • Screening for receptor expression through radioligand binding assays

When establishing any expression system, it's critical to maintain cell culture conditions that support receptor expression without inducing significant changes in receptor coupling or trafficking. Cells should be maintained in appropriate growth medium supplemented with selection antibiotics for stable transfectants .

How can I optimize radioligand binding assays for sheep ADORA3?

Optimizing radioligand binding assays for sheep ADORA3 requires careful consideration of several factors:

Recommended radioligand: N6-amino[125I]iodobenzyladenosine ([125I]ABA) has been shown to bind with high affinity (Kd ≈ 6 nM) and specificity to recombinant sheep A3 adenosine receptors .

Membrane preparation protocol:

  • Wash cell monolayers with PBS

  • Harvest cells in buffer containing 10 mM Na-Hepes, 10 mM EDTA, pH 7.4, supplemented with protease inhibitors

  • Homogenize cells using a glass homogenizer

  • Centrifuge at low speed to remove nuclei and unbroken cells

  • Collect membranes by high-speed centrifugation

  • Resuspend in binding buffer with appropriate protein concentration

Binding assay conditions:

  • Incubate membranes (25-50 μg protein) with 1 nM [125I]ABA in binding buffer

  • Include adenosine deaminase (1 U/ml) to remove endogenous adenosine

  • Define nonspecific binding using 10 μM non-radioactive I-ABA

  • Incubate for 2 hours at room temperature

  • Terminate binding by filtration through glass fiber filters

  • For competition studies, include various concentrations of test compounds

Data analysis:

  • For saturation binding, fit data to a single site hyperbolic equation

  • For competition binding, fit data to a four-parameter logistic equation:
    B = B0[1−[I]N/(IC50N + IN)]
    where B = specific binding, B0 = specific binding without inhibitor, [I] = inhibitor concentration, and N = Hill coefficient

What methods are most effective for studying sheep ADORA3-mediated signaling?

Several approaches have proven effective for studying sheep ADORA3-mediated signaling pathways:

cAMP Assays:

  • Harvest cells expressing sheep ADORA3 in PBS/EDTA

  • Resuspend in serum-free Hepes-buffered medium (pH 7.2)

  • Preincubate with adenosine deaminase (1 U/ml)

  • Stimulate cAMP production with forskolin or isoproterenol (1 μM)

  • Add phosphodiesterase inhibitors (e.g., Ro-20-1724, 20 μM)

  • Treat with agonists at various concentrations

  • Incubate for 15 minutes at room temperature

  • Measure cAMP levels using appropriate assay methods

This approach allows for quantification of ADORA3-mediated inhibition of adenylyl cyclase, with agonists typically reducing forskolin-stimulated cAMP by 30-50% .

Antagonist Studies:

  • Perform dose-response curves of agonist-induced cAMP inhibition in the presence of increasing concentrations of antagonists

  • Analyze data using Schild plots to determine antagonist potencies

  • Correlate antagonist potencies determined by functional assays with those established by competition binding

How do xanthine-based antagonists interact with sheep ADORA3 compared to other species?

The interaction of xanthine-based antagonists with sheep ADORA3 reveals interesting species differences that are crucial for pharmacological research:

Sheep ADORA3 shows notable affinity for certain xanthine derivatives, particularly those with acidic para-substituents on the 8-phenyl ring. This characteristic distinguishes it from rat A3 receptors, which display very weak affinity for most xanthine antagonists .

Key observations on xanthine antagonist interactions:

  • Sheep ADORA3 preferentially binds 8-phenylxanthines with acidic versus basic para-substituents

  • The potency order is: I-ABOPX > BW-A1433 > 1,3-dipropyl-8-sulfophenylxanthine = xanthine amine cogener (XAC)

  • The compound 3-(3-iodo-4-aminobenzyl)-8-(4-oxyacetate)phenyl-1-propylxanthine (I-ABOPX) shows particularly high affinity with a Ki of approximately 3 nM

  • 8-cyclopentyl-1,3-dipropylxanthine (CPX) shows poor binding to sheep ADORA3

These pharmacological differences provide valuable tools for differentiating between adenosine receptor subtypes in experimental settings and highlight the importance of species considerations when developing receptor-specific compounds.

What is known about the binding of inosine and other adenosine metabolites to sheep ADORA3?

Inosine, a metabolite of adenosine that can accumulate to millimolar concentrations in ischemic tissues, has been found to interact with A3 adenosine receptors. While most of the direct binding studies have been performed with rat A3 receptors, the data can inform research on sheep ADORA3:

Inosine binding characteristics:

  • Inosine competes for radioligand binding to recombinant rat A3 adenosine receptors with an IC50 of approximately 25 μM

  • This interaction appears selective for A3 receptors, as inosine shows little or no binding to A1 or A2A adenosine receptors

  • In guinea pig lung, which contains A3-like binding sites, inosine binds with an IC50 of approximately 15 μM

Functional consequences:

  • Inosine can lower cyclic AMP in cells expressing rat A3 receptors (ED50 ≈ 12 μM)

  • The compound stimulates mast cell degranulation through an A3 receptor-dependent mechanism

Given the structural similarities between rat and sheep ADORA3 (72% identity), researchers should consider the potential physiological role of inosine as an A3 receptor ligand in sheep tissues, particularly under conditions of metabolic stress or ischemia.

How does G-protein coupling of sheep ADORA3 differ from other adenosine receptor subtypes?

  • Inhibition of cAMP production: Activation of sheep ADORA3 by agonists reduces forskolin-stimulated cAMP accumulation in transfected cells. This inhibition is blocked by specific antagonists like BW-A1433 but not by 8-cyclopentyl-1,3-dipropylxanthine, highlighting the selective nature of the coupling .

  • G-protein states: Radioligand binding studies suggest that recombinant ADORA3 exists in two affinity states representing G protein-coupled and uncoupled receptors. The majority of overexpressed recombinant A3 receptors appear to be in the uncoupled state, as indicated by curvilinear Scatchard plots .

  • Comparison with other adenosine receptors: While A1 and A3 receptors both couple to Gi/o to inhibit adenylyl cyclase, A2A and A2B receptors couple to Gs to stimulate cAMP production. This fundamental difference in signaling direction provides a basis for developing functional assays that can differentiate between receptor subtypes .

  • Potential additional signaling pathways: Beyond cAMP inhibition, research suggests that A3 receptors may couple to other signaling pathways, including phospholipase C activation and calcium mobilization, though these aspects have been less extensively characterized for the sheep receptor specifically.

What are the potential physiological roles of sheep ADORA3 based on its tissue distribution?

The unique tissue distribution pattern of sheep ADORA3 suggests several potential physiological roles that merit investigation:

Respiratory function: The high expression in lung tissue suggests potential involvement in bronchial tone regulation, inflammatory responses, or pulmonary vascular function . This could be particularly relevant for respiratory conditions such as asthma or chronic obstructive pulmonary disease.

Immune modulation: Abundant expression in spleen and moderate expression in other immune tissues suggests a role in immune regulation . A3 receptor activation has been linked to mast cell degranulation and other immune functions in various species .

Neuroendocrine functions: The presence in pineal gland and pars tuberalis suggests potential roles in circadian rhythm regulation or neuroendocrine signaling . This might include modulation of melatonin production or other hormonal pathways.

Central nervous system: Moderate expression in brain tissues indicates possible roles in neuronal function, which could include neuroprotection during ischemia or modulation of neurotransmitter release .

The widespread distribution pattern, which more closely resembles human than rat expression profiles, suggests that sheep may provide a better translational model than rodents for studying certain adenosine-mediated physiological processes .

How can differences in ADORA3 pharmacology between species impact translational research?

The significant species differences in ADORA3 pharmacology have important implications for translational research:

Sequence divergence: The sheep ADORA3 shows 72% identity with rat and 85% identity with human receptors . This divergence results in notable pharmacological differences that researchers must consider when extrapolating findings across species.

Antagonist sensitivity differences: While rat ADORA3 shows poor affinity for xanthine antagonists, sheep ADORA3 binds certain xanthines (particularly those with acidic para-substituents) with relatively high affinity . This creates challenges when using antagonists across different experimental models.

Distribution pattern variations: The predominantly testicular expression of rat ADORA3 contrasts sharply with the widespread distribution in sheep and humans . This suggests that physiological roles may differ significantly between rodents and larger mammals.

Translational considerations:

  • Sheep models may better represent human ADORA3 biology than rat models for certain applications

  • Pharmacological tools developed based on one species may not have equivalent effects in other species

  • Drug development programs targeting ADORA3 must account for species differences in binding pocket structure and affinity

  • Tissue-specific effects observed in one species may not translate to others due to distribution differences

What are the common challenges in differentiating between ADORA3 and other adenosine receptor subtypes?

Researchers frequently encounter difficulties in isolating ADORA3-specific effects due to the presence of multiple adenosine receptor subtypes in most tissues. Several strategies can help address these challenges:

Pharmacological approaches:

  • Utilize selective compounds like N6-aminoiodobenzyladenosine, which shows higher affinity for ADORA3 than other subtypes

  • Employ the antagonist I-ABOPX, which has high affinity for sheep ADORA3 (Ki = 3 nM)

  • Use the compound WRC-0571, which effectively blocks A1 receptors but has very low affinity for A3 receptors (IC50 > 200 μM for rat A3)

Experimental design strategies:

  • Pre-block A1 and A2 receptors with selective antagonists before studying ADORA3 responses

  • Use recombinant expression systems with no endogenous adenosine receptors (e.g., transfected HEK-293 cells)

  • Employ membrane preparation techniques that maximize ADORA3 content relative to other subtypes

  • Design binding studies that can distinguish between receptor subtypes, such as those using WRC-0571 to block A1 binding sites

Molecular approaches:

  • Use RNA interference to selectively suppress ADORA3 expression

  • Develop cell lines with genetic knockouts of other adenosine receptor subtypes

  • Utilize quantitative PCR to correlate receptor subtype expression with functional responses

What are the optimal conditions for radioligand binding studies with sheep ADORA3?

Successful radioligand binding studies with sheep ADORA3 require careful optimization of several parameters:

Radioligand selection and handling:

  • [125I]ABA (N6-amino[125I]iodobenzyladenosine) is the preferred radioligand, demonstrating high affinity (Kd ≈ 6 nM)

  • Store radioligand according to manufacturer recommendations, typically at -20°C in ethanol

  • Monitor radiochemical purity regularly through thin-layer chromatography

Membrane preparation optimization:

  • Harvest cells at 80-90% confluence for optimal receptor expression

  • Include protease inhibitors in all buffers to prevent receptor degradation

  • Perform homogenization steps on ice to maintain protein integrity

  • Standardize protein concentration (typically 25-50 μg per assay tube)

  • Use freshly prepared membranes or store at -80°C with minimal freeze-thaw cycles

Binding assay conditions:

  • Conduct assays in 50 mM Tris-HCl buffer (pH 7.4) containing 10 mM MgCl2

  • Include adenosine deaminase (1 U/ml) to remove endogenous adenosine

  • Optimize incubation time and temperature (typically 2 hours at room temperature)

  • For competition studies, use a wide concentration range of competing ligands (10-10 to 10-4 M)

  • Define nonspecific binding using 10 μM non-radioactive I-ABA

Data analysis considerations:

  • Account for potential radioligand depletion when receptor expression is high

  • Consider the possibility of multiple affinity states when analyzing competition curves

  • Use appropriate mathematical models that can accommodate Hill coefficients different from unity

  • Calculate protein concentration accurately to determine Bmax values

How can I design experiments to study desensitization and internalization of sheep ADORA3?

Studying the regulation mechanisms of sheep ADORA3 requires careful experimental design to capture the dynamic processes of desensitization and internalization:

Desensitization studies:

  • Functional assays: Measure cAMP inhibition after pre-exposure to agonists for varying time periods (5 min to 24 hours)

  • Timecourse experiments: Determine the kinetics of desensitization by measuring signaling at multiple timepoints after agonist addition

  • Concentration-dependence: Assess how different agonist concentrations affect the rate and extent of desensitization

  • Recovery experiments: After removing the desensitizing agonist, monitor the time course of receptor resensitization

Internalization approaches:

  • Fluorescent tagging: Generate sheep ADORA3 constructs with C-terminal GFP or other fluorescent tags to visualize receptor trafficking

  • Surface biotinylation: Label surface receptors with biotin and monitor their internalization over time

  • Confocal microscopy: Use immunofluorescence with receptor-specific antibodies to track receptor localization

  • Flow cytometry: Quantify surface receptor expression before and after agonist treatment

Molecular mechanisms:

  • Phosphorylation studies: Use phospho-specific antibodies or 32P labeling to detect receptor phosphorylation

  • Mutational analysis: Generate serine/threonine mutants to identify key residues involved in desensitization

  • Inhibitor studies: Use inhibitors of G protein-coupled receptor kinases (GRKs) or arrestins to determine their role in ADORA3 regulation

  • Co-immunoprecipitation: Identify proteins that interact with the receptor during desensitization and internalization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.