Recombinant Sheep Amiloride-sensitive sodium channel subunit beta (SCNN1B)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The SCNN1B gene encodes the beta subunit of the epithelial sodium channel (ENaC), a heterotrimeric protein complex (α, β, γ) responsible for sodium reabsorption in epithelial tissues. Recombinant Sheep SCNN1B is produced via heterologous expression systems to investigate ENaC function, structure, and dysregulation in diseases such as Liddle syndrome and pseudohypoaldosteronism type 1 (PHA1) .

Production and Purification Methods

Recombinant Sheep SCNN1B is typically synthesized using:

  • Expression Systems: E. coli (cost-effective) or mammalian cells (post-translational modifications) .

  • Tags: Strep-tag or His-tag for affinity purification .

  • Quality Control: Validated via Western blot, ELISA, and functional assays (e.g., electrophysiology) .

In Vitro and In Vivo Studies

ApplicationFindings
Liddle Syndrome ModelsTruncated SCNN1B mutants cause hypertension due to hyperactive ENaC channels .
PHA1 PathogenesisFrameshift mutations (e.g., c.1290delA) result in nonfunctional ENaC, causing severe hyperkalemia and metabolic acidosis .
Lung Function StudiesOverexpression in transgenic mice (Scnn1b-Tg) enhances airway surface liquid absorption but increases susceptibility to hyperoxia-induced lung injury .

Pathophysiological Implications

  • Electrolyte Homeostasis: Loss-of-function SCNN1B mutations impair renal sodium reabsorption, leading to hyponatremia and hyperkalemia .

  • Airway Disease: Elevated ENaC activity in Scnn1b transgenic sheep correlates with reduced mucus clearance and early inflammatory responses in cystic fibrosis models .

  • Therapeutic Targets: Amiloride (ENaC inhibitor) mitigates hypertension in Liddle syndrome but exacerbates alveolarization defects in neonatal lungs .

Comparative Data Across Species

SpeciesHost SystemPurityApplications
Sheep (Ovis aries)E. coli≥85%Immunogen, WB, functional assays
HumanMammalian cells≥90%Drug screening, structural studies
RatYeast≥85%Electrophysiology, ligand-binding assays

Key Research Findings

  1. Hyperoxia Sensitivity: Scnn1b-overexpressing neonatal mice exposed to 85% O₂ show reduced respiration rates and alveolar simplification, implicating ENaC in oxidative stress responses .

  2. Compound Heterozygosity: Dual SCNN1B frameshift mutations (e.g., p.Gln431ArgfsTer2 and p.Thr451AspfsTer6) cause neonatal mortality due to ENaC dysfunction .

  3. Inflammatory Markers: CFTR-deficient sheep with altered SCNN1B expression exhibit upregulated inflammatory pathways (e.g., CHI3L1, C4A) in prenatal lungs .

Clinical and Industrial Relevance

  • Diagnostics: Recombinant SCNN1B serves as an antigen for antibody development (e.g., Rabbit polyclonal antibodies for Western blot) .

  • Drug Development: Used to screen ENaC modulators for conditions like cystic fibrosis and hypertension .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributor for specific delivery details.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag selection is determined during production. If you have a specific tag requirement, please communicate it to us, and we will prioritize its implementation.
Synonyms
SCNN1B; ENAC; Amiloride-sensitive sodium channel subunit beta; Beta-NaCH; Epithelial Na(+ channel subunit beta; Beta-ENaC; Nonvoltage-gated sodium channel 1 subunit beta; SCNEB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
SCNN1B
Target Protein Sequence
MHLKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFT SLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDALME AVLGRILGPELSQVNATTALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASSSPA PGRPCSARRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMG YPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLIL DMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYS QCTKNGSDVPIQNLYSSYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPDKRKYCNNQE FPDWAHCYSALRISMAQRETCIYACKESCKLLGTSPPLPPCLLPPVSPQDWIFHVLSQER DQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIE FGEIIIDFVWITIIKLVALAKSVRGPPPTVAELVEAHTNFGFQPDSAMPGPDAGAYRREQ NPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Uniprot No.

Target Background

Function
This protein is a sodium-permeable, non-voltage-sensitive ion channel inhibited by the diuretic amiloride. It mediates the electrodiffusion of luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. This protein plays a crucial role in electrolyte and blood pressure homeostasis, as well as in airway surface liquid homeostasis, which is essential for efficient mucus clearance. It regulates sodium reabsorption in the kidney, colon, lung, and sweat glands. Additionally, it contributes to taste perception.
Database Links

UniGene: Oar.614

Protein Families
Amiloride-sensitive sodium channel (TC 1.A.6) family, SCNN1B subfamily
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.

Q&A

What is the functional significance of SCNN1B in epithelial tissue?

SCNN1B is a critical subunit of the epithelial sodium channel (ENaC) that regulates sodium absorption across epithelial surfaces. In physiological contexts, SCNN1B combines with other subunits (alpha and gamma) to form a functional ion channel that plays an essential role in maintaining sodium homeostasis in multiple tissues including kidneys, lungs, and intestines.

The protein functions as a non-voltage-gated sodium channel, allowing the passive movement of sodium ions across cell membranes according to electrochemical gradients. Its activity is specifically inhibited by the diuretic amiloride, which has made it an important pharmacological target. In research contexts, understanding sheep SCNN1B provides valuable comparative data for evolutionary studies of ion channel proteins and potential insights into species-specific adaptations in sodium handling.

What expression systems are optimal for producing recombinant sheep SCNN1B?

Recombinant sheep SCNN1B (AA 1-221) is typically expressed in yeast expression systems, which provide several advantages for membrane protein production . Yeast systems offer:

  • Post-translational modifications similar to mammalian systems

  • Proper protein folding machinery

  • High protein yield

  • Cost-effectiveness compared to mammalian cell systems

While sheep SCNN1B can be produced in yeast, other SCNN1B variants from different species utilize alternative expression systems:

SpeciesExpression SystemConstruct LengthPurification TagPurity
SheepYeastAA 1-221His tag>90%
HumanHEK-293 CellsAA 1-640His tag>90%
MouseCell-free protein synthesisAA 1-638Strep Tag>70-80%
DogYeastAA 1-88His tag>90%

For optimal functional studies, the expression system should be selected based on the specific research application and required post-translational modifications. Yeast expression for sheep SCNN1B results in proteins with >90% purity suitable for ELISA applications .

How do I verify the identity and integrity of recombinant sheep SCNN1B?

Verification of recombinant sheep SCNN1B should involve multiple complementary techniques:

  • SDS-PAGE analysis: Visualize protein size and initial purity assessment

  • Western blot detection: Using either anti-His tag antibodies (for tag detection) or specific anti-SCNN1B antibodies

  • Mass spectrometry: For precise molecular weight determination and sequence coverage verification

  • N-terminal sequencing: To confirm proper translation initiation and signal peptide processing

  • Analytical SEC (HPLC): To assess homogeneity and oligomeric state

For functional verification, electrophysiological studies or amiloride binding assays should be conducted to confirm that the recombinant protein retains its native properties. Different recombinant SCNN1B proteins may require specific validation techniques depending on their expression system, as seen with human SCNN1B expressed in HEK-293 cells, which is typically verified using Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) .

What are the optimal conditions for using sheep SCNN1B in ELISA assays?

When using recombinant sheep SCNN1B in ELISA assays, the following protocol optimizations are recommended:

  • Coating concentration: 1-5 μg/mL of recombinant sheep SCNN1B (AA 1-221) in carbonate-bicarbonate buffer (pH 9.6)

  • Coating temperature and time: 4°C overnight or 37°C for 2 hours

  • Blocking solution: 3-5% BSA or non-fat dry milk in PBS-T (PBS with 0.05% Tween-20)

  • Primary antibody dilutions: Start with 1:1000 and optimize based on signal-to-noise ratio

  • Detection system: HRP-conjugated secondary antibody with TMB substrate for colorimetric detection

The high purity (>90%) of recombinant sheep SCNN1B expressed in yeast makes it particularly suitable for ELISA applications . When designing sandwich ELISA assays, ensure that capture and detection antibodies recognize different epitopes to prevent competitive binding.

How can I determine the optimal buffer conditions for sheep SCNN1B stability?

Determining optimal buffer conditions for sheep SCNN1B stability requires systematic testing of various parameters:

  • pH screening: Test stability across pH range 6.0-8.5 in 0.5 increments

  • Buffer composition: Compare phosphate, Tris, HEPES, and MES buffers

  • Salt concentration: Typically 100-300 mM NaCl provides optimal stability

  • Additives for stability:

    • Glycerol (10-20%)

    • Reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

    • Protease inhibitors

    • Mild detergents for membrane proteins (0.01-0.1% DDM or CHAPS)

Stability should be monitored using multiple techniques such as dynamic light scattering, thermal shift assays, and activity measurements over time. Standard storage buffer commonly used for similar proteins includes PBS pH 7.4 with 10% Glycerol . For long-term storage, aliquot the protein and store at -80°C to avoid repeated freeze-thaw cycles.

What methods are recommended for studying sheep SCNN1B interactions with regulatory proteins?

To study sheep SCNN1B interactions with regulatory proteins, several complementary approaches are recommended:

  • Co-immunoprecipitation (Co-IP): Using antibodies against SCNN1B or the regulatory protein of interest

  • Pull-down assays: Leveraging the His-tag on recombinant sheep SCNN1B (AA 1-221)

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics determination

  • Bioluminescence Resonance Energy Transfer (BRET): For live-cell interaction studies

  • Proximity Ligation Assay (PLA): For detecting protein interactions in fixed cells or tissues

When designing these experiments, consider:

  • Using appropriate controls (mutated proteins, unrelated proteins)

  • Testing interactions in both physiological and pathophysiological conditions

  • Confirming interactions using multiple independent techniques

  • Determining the functional consequences of the interaction on channel activity

The high purity of recombinant sheep SCNN1B makes it well-suited for interaction studies that require minimal contaminants that could interfere with binding measurements .

How can I use recombinant sheep SCNN1B to investigate species-specific differences in ENaC regulation?

Investigating species-specific differences in ENaC regulation using sheep SCNN1B requires a comparative approach:

  • Sequence alignment analysis: Compare sheep SCNN1B to other species (human, mouse, dog) to identify conserved and divergent regions

  • Domain swap experiments: Create chimeric proteins containing regions from different species to identify functionally important domains

  • Site-directed mutagenesis: Target specific amino acids that differ between species to assess their functional significance

  • Electrophysiological studies: Measure channel conductance, open probability, and response to regulators in heterologous expression systems

  • Pharmacological profiling: Compare sensitivity to amiloride and other ENaC modulators across species

This comparative approach can reveal evolutionary adaptations in sodium handling mechanisms. For instance, comparative studies between sheep, human, and mouse SCNN1B can highlight adaptations related to different dietary sodium intake and environmental conditions. Experiments should be designed with appropriate controls, including parallel studies using human SCNN1B (AA 1-640) expressed in HEK-293 cells .

What role does SCNN1B play as a genetic modifier in disease models, and how can recombinant proteins help study this?

SCNN1B functions as a genetic modifier in several disease contexts, particularly in cystic fibrosis (CF). Studies have identified specific SNPs in SCNN1B that modify disease severity in CF patients homozygous for the F508del-CFTR mutation . Recombinant protein studies can help elucidate the molecular mechanisms behind these effects through:

  • Functional characterization of variant proteins: Producing recombinant SCNN1B proteins containing disease-associated variants

  • Electrophysiological studies: Measuring how variants affect channel conductance and regulation

  • Protein-protein interaction studies: Determining if variants alter interactions with regulatory proteins

  • Trafficking studies: Examining if variants affect cell surface expression

  • Reconstitution experiments: Combining SCNN1B variants with other ENaC subunits to study heteromeric channel function

For example, the SNP rs2303153 between exon 11 and exon 12 in SCNN1B has been identified as a regulatory element that differentiates between mildly and severely affected CF patients . Recombinant protein studies can help elucidate how this variant affects SCNN1B function at the molecular level.

What methodologies are available for studying sheep SCNN1B post-translational modifications?

Studying post-translational modifications (PTMs) of sheep SCNN1B requires specialized techniques:

  • Mass spectrometry approaches:

    • Shotgun proteomics for global PTM mapping

    • Targeted proteomics for specific PTM sites

    • Top-down proteomics for intact protein analysis

  • Site-specific analysis methods:

    • Phospho-specific antibodies

    • Glycan-specific staining and binding assays

    • Ubiquitination detection using specific antibodies

  • Functional impact assessment:

    • Site-directed mutagenesis of PTM sites

    • Inhibitors of specific PTM-adding enzymes

    • In vitro enzymatic assays to recreate PTMs

The yeast expression system used for sheep SCNN1B (AA 1-221) provides capabilities for many eukaryotic PTMs, though there may be species-specific differences in glycosylation patterns . When studying PTMs, it's essential to compare results from recombinant proteins with those from native tissues to ensure physiological relevance.

What are common issues encountered when working with recombinant sheep SCNN1B and how can they be resolved?

Researchers commonly encounter several challenges when working with recombinant sheep SCNN1B:

  • Low expression yield:

    • Solution: Optimize codon usage for expression host

    • Solution: Test different promoters and induction conditions

    • Solution: Consider using fusion partners to enhance solubility

  • Protein aggregation:

    • Solution: Include detergents appropriate for membrane proteins

    • Solution: Reduce expression temperature

    • Solution: Add stabilizing agents (glycerol, specific ions)

  • Insufficient purity:

    • Solution: Implement multi-step purification strategy

    • Solution: Optimize imidazole concentration gradients for His-tagged proteins

    • Solution: Consider size exclusion chromatography as a final polishing step

  • Loss of activity:

    • Solution: Minimize freeze-thaw cycles

    • Solution: Add protease inhibitors during purification

    • Solution: Optimize buffer conditions for stability

For sheep SCNN1B expressed in yeast with >90% purity, activity loss over time is a common issue that can be mitigated by proper storage conditions and minimizing handling steps .

How should I design experiments to compare sheep SCNN1B with SCNN1B from other species?

When designing comparative experiments between sheep SCNN1B and other species variants, consider the following methodological approach:

  • Standardize expression and purification protocols:

    • Use similar tags (His-tag is common across species variants)

    • Apply identical purification strategies

    • Verify comparable purity levels (>90% for meaningful comparisons)

  • Functional characterization controls:

    • Include positive controls with known activity

    • Perform parallel measurements under identical conditions

    • Normalize data to account for concentration differences

  • Experimental design considerations:

    • Use matched protein fragments (e.g., comparing AA 1-221 regions across species)

    • Account for differences in post-translational modifications

    • Consider the impact of expression system (yeast vs. HEK-293 vs. cell-free)

  • Data analysis approach:

    • Apply appropriate statistical tests for cross-species comparisons

    • Consider evolutionary relationships when interpreting differences

    • Correlate functional differences with structural variations

The available recombinant proteins from different species (sheep, human, mouse, dog) provide excellent opportunities for comparative studies that can reveal evolutionary adaptations and species-specific features of SCNN1B function .

What genetic analysis methods are recommended when studying SCNN1B variants and their functional implications?

When studying SCNN1B genetic variants and their functional implications, a comprehensive genetic analysis approach is recommended:

  • Genotyping methods:

    • SNPstream high-throughput genotyping for known variants

    • PCR-RFLP for specific variant confirmation

    • Next-generation sequencing for novel variant discovery

  • Association study design:

    • Case-control studies for disease association

    • Family-based studies for hereditary traits

    • Genome-wide association studies for broader genetic context

  • Functional prediction tools:

    • In silico analysis of variant effects on protein structure

    • Splicing prediction algorithms for intronic variants

    • Conservation analysis across species

  • Experimental validation:

    • In vitro expression of variant proteins

    • Electrophysiological characterization

    • Cell-based functional assays

For example, studies on SCNN1B as a modifier gene in cystic fibrosis have employed SNPstream high-throughput genotyping and PCR-RFLP to analyze variants like rs2303153, which was found to distinguish between mildly and severely affected CF patients . Combining genetic analysis with functional studies using recombinant proteins provides the most comprehensive understanding of variant effects.

How might recombinant sheep SCNN1B contribute to comparative physiology and evolutionary studies?

Recombinant sheep SCNN1B offers unique opportunities for comparative physiology and evolutionary studies through:

  • Evolutionary adaptation analysis: Sheep have evolved in diverse environments with varying salt availability, potentially leading to adaptations in sodium channel function that could be revealed through comparative studies with other ruminants and non-ruminant species.

  • Structural-functional relationships: Comparing the structure and function of sheep SCNN1B (AA 1-221) with equivalent regions from human, mouse, and dog variants can identify conserved functional domains versus species-specific adaptations .

  • Regulatory mechanism conservation: Studies comparing how sheep SCNN1B responds to various regulatory factors (hormones, intracellular signals) compared to other species can reveal evolutionary conservation or divergence in channel regulation pathways.

  • Pharmacological response profiles: Species-specific differences in response to channel blockers like amiloride may provide insights into structural variations at drug binding sites and inform the development of more selective compounds.

  • Genetic modifier studies: Understanding how sheep SCNN1B genetic variants influence physiology could provide comparative insights relevant to human conditions where SCNN1B acts as a genetic modifier, such as in cystic fibrosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.