Recombinant Sheep Antigen-presenting glycoprotein CD1d (CD1D)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

CD1d is a 48 kDa transmembrane glycoprotein consisting of an extracellular domain, a transmembrane segment, and an intracellular tail. The sheep CD1d variant spans residues 18–335, excluding the signal peptide. Key structural features include:

ParameterSpecification
SourceE. coli
TagN-terminal His tag
LengthFull-length mature protein (18–335 aa)
Purity>90% (SDS-PAGE)
Amino Acid SequenceSFEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESSTIRFLKHWSQGTFSDQQWEQLQHTFQVYRSSFTRDIREFVKMLPGDYPFEIQISGGCELLPRNISESFLRAALQEKDVLSFQGMSWVSAPDAPPWSQVVCKVLNEDQGTKETVHWLLHDICPELVKGLMQTGKSELEKQVKPEAWLSSGPSPGPDRLLLGCHVSGFYPKPVWVMWMRGEQEEPGTQQGDVMPNADSTWYLRVTLEVAAGEAAGLSCRVKHSSLGDQDIILYWDGKRVSRGLIVVLVILVFVLLFVGGLVFWFRKHRRYQDIS

The recombinant protein is lyophilized in a Tris/PBS-based buffer with 6% trehalose and stored at −20°C/−80°C .

Biological Function

CD1d binds self- and non-self glycolipids, presenting them to invariant natural killer T (iNKT) cells. This interaction triggers rapid cytokine secretion (e.g., IFN-γ, IL-4) and modulates immune responses .

Key Functional Properties:

  1. Antigen Presentation

    • Glycolipid Binding: Recognizes α-galactosylceramide (α-GalCer), bacterial lipids (e.g., mycolic acid), and endogenous lipids (e.g., iGb3) .

    • Endosomal Recycling: Internalization into endosomal compartments enables loading of exogenous lipids, a critical step for antigen presentation .

  2. Immunological Roles

    • NKT Cell Activation: CD1d-restricted iNKT cells bridge innate and adaptive immunity, producing both Th1 (IFN-γ) and Th2 (IL-4, IL-13) cytokines .

    • Liver Protection: Hepatocyte CD1d suppresses immunopathology in schistosomiasis and non-alcoholic steatohepatitis (NASH) by regulating NKT cell responses and STAT3 signaling .

Research Applications

The recombinant sheep CD1d protein is utilized in diverse experimental systems:

ApplicationDetails
Antigen Presentation AssaysTesting lipid loading and NKT cell activation via ELISpot or cytokine assays
Hepatocyte StudiesModeling CD1d-mediated protection against liver fibrosis and inflammation
Vaccine DevelopmentInvestigating α-GalCer-based vaccines for microbial infections
Protein Interaction StudiesELISA/Western blotting to study CD1d-lipid interactions or receptor binding

Liver Immunopathology

  • Schistosomiasis: Overexpression of CD1d in hepatocytes reduces liver granuloma size and ALT/AST levels in Schistosoma japonicum-infected mice, suggesting a role in mitigating Th1/Th2-driven tissue damage .

  • NASH: Hepatocyte CD1d knockdown exacerbates apoptosis and inflammation, while overexpression enhances JAK2-STAT3 signaling, protecting against lipotoxicity .

Antigen Presentation Mechanisms

  • α-GalCer Processing: Human iNKT cells recognize α-GalCer presented by CD1d, even in murine systems, highlighting cross-species functionality .

  • Endosomal Loading: Long-chain lipids (e.g., glucose monomycolate) require endosomal processing for CD1d-mediated presentation .

Comparative Analysis with Other CD1d Variants

ParameterSheep CD1dHuman CD1dMouse CD1d
Expression SystemE. coli E. coli or mammalian cellsE. coli or mammalian cells
TagHis-tag His-tag or SUMO-tag His-tag
Purity>90% (SDS-PAGE) >90% (SDS-PAGE) >90% (SDS-PAGE)
Key Ligandα-GalCer, bacterial lipids α-GalCer, iGb3 α-GalCer, iGb3

Challenges and Considerations

  • Species Specificity: Sheep CD1d may differ in ligand binding or NKT cell activation compared to human or murine homologs, requiring cross-validation .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting and storage at −20°C/−80°C are recommended .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CD1D; Antigen-presenting glycoprotein CD1d; CD antigen CD1d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-335
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
SFEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESSTIRFLKHWSQGTFSDQQWEQLQHTFQVYRSSFTRDIREFVKMLPGDYPFEIQISGGCELLPRNISESFLRAALQEKDVLSFQGMSWVSAPDAPPWSQVVCKVLNEDQGTKETVHWLLHDICPELVKGLMQTGKSELEKQVKPEAWLSSGPSPGPDRLLLGCHVSGFYPKPVWVMWMRGEQEEPGTQQGDVMPNADSTWYLRVTLEVAAGEAAGLSCRVKHSSLGDQDIILYWDGKRVSRGLIVVLVILVFVLLFVGGLVFWFRKHRRYQDIS
Uniprot No.

Target Background

Function
CD1d is an antigen-presenting protein that binds both self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells.
Database Links

KEGG: oas:100144424

UniGene: Oar.1049

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Q&A

What is CD1D and what is its role in the immune system?

CD1D (CD1d molecule) is a divergent member of the CD1 family of transmembrane glycoproteins that are structurally related to major histocompatibility complex (MHC) proteins. Unlike conventional MHC molecules that present peptide antigens, CD1D specializes in presenting lipid and glycolipid antigens to T cells. CD1D forms heterodimers with beta-2-microglobulin, creating a complex capable of binding and presenting self and non-self glycolipids .

The primary immunological function of CD1D is to present lipid antigens to natural killer T (NKT) cells, particularly invariant NKT cells (iNKT) that express a highly conserved T-cell receptor. Upon recognition of CD1D-presented glycolipids, these NKT cells rapidly produce both Th1 and Th2 cytokines, acting as critical regulators of immune responses .

CD1D plays significant roles in antimicrobial defense, tumor surveillance, autoimmunity, and regulation of inflammatory responses. Recent studies have also implicated CD1D in lipid metabolism control, with CD1D-deficient macrophages showing altered metabolic profiles and responses to pathogen-associated molecular patterns .

What are the structural characteristics of recombinant sheep CD1D?

Recombinant sheep CD1D shares the fundamental structural architecture of other mammalian CD1D proteins. While specific sheep CD1D structural data is limited, extrapolation from better-characterized mammalian CD1D molecules suggests it consists of an extracellular domain containing an antigen-binding groove specialized for lipid binding, a transmembrane segment, and a cytoplasmic tail .

The extracellular portion of sheep CD1D likely contains a hydrophobic binding groove formed by two α-helices positioned above a β-sheet platform. This groove, characteristic of CD1 family members, typically contains two large hydrophobic pockets (A' and F') designed to accommodate the acyl chains of lipid antigens, while the polar head groups of the lipids remain exposed for T cell receptor recognition .

The cytoplasmic tail of sheep CD1D probably contains a tyrosine-based motif responsible for its intracellular trafficking through endosomal/lysosomal compartments, which is essential for loading with diverse glycolipid antigens. This trafficking pattern enables CD1D to sample lipids from various cellular compartments, similar to what has been observed in human and mouse CD1D .

How does sheep CD1D compare to human and mouse CD1D in terms of structure and function?

Comparative analysis of sheep CD1D with human and mouse counterparts reveals both conserved and species-specific features. While precise sequence homology percentages for sheep CD1D are not provided in the available data, other mammalian species show significant conservation. For instance, mouse CD1d1 shares 65% amino acid sequence identity with human CD1d within the extracellular domain .

Functionally, sheep CD1D likely follows the conserved pattern of presenting lipid antigens to NKT cells, but with potential species-specific preferences for certain lipid antigens. An important structural difference worth noting is that mice possess two CD1D genes (CD1d1 and CD1d2), whereas humans, rats, and likely sheep have only a single CD1D gene , suggesting evolutionary divergence in the CD1 system among mammals.

The binding specificities for glycolipid antigens may differ between sheep CD1D and other mammalian CD1D proteins, which would impact experimental design when using sheep CD1D for antigen presentation studies. These species-specific differences should be considered when extrapolating findings from mouse or human studies to sheep systems .

What glycolipids are known to bind to sheep CD1D?

While the specific glycolipid binding profile of sheep CD1D has not been extensively characterized in the provided search results, insights can be drawn from well-studied CD1D molecules in other species. α-Galactosylceramide (α-GalCer), a glycosphingolipid originally isolated from marine sponges, is a potent ligand for CD1D across multiple species and likely binds sheep CD1D as well .

Glycosylphosphatidylinositol (GPI) has been identified as a major CD1D-associated component in mice and may similarly associate with sheep CD1D. Isoglobotrihexosylceramide (iGb3), an endogenous glycosphingolipid, has been demonstrated to bind CD1D in several species and activate NKT cells .

The binding specificity of sheep CD1D to these and other glycolipids would need to be experimentally determined, as subtle structural differences in the binding groove can significantly impact antigen preference. Researchers working with sheep CD1D should validate binding of specific glycolipids rather than assuming identical binding profiles across species .

What are the main applications of recombinant sheep CD1D in research?

Recombinant sheep CD1D serves as a valuable tool for numerous immunological applications. Primary among these is studying the sheep CD1D-restricted NKT cell populations through immunofluorescent staining and flow cytometric analysis. Similar to mouse CD1d:Ig fusion proteins described in the literature, sheep CD1D constructs can be used to identify and enumerate antigen-specific NKT cells in sheep samples .

Additionally, recombinant sheep CD1D can be employed to investigate species-specific immune responses to various pathogens relevant to sheep, particularly those involving lipid components. This is especially valuable for veterinary immunology research and understanding host-pathogen interactions in ruminants .

Recombinant sheep CD1D is also useful for comparative immunology studies to elucidate evolutionary conservation and divergence in lipid antigen presentation across species. Such studies contribute to our fundamental understanding of the mammalian immune system and can identify unique features of ruminant immunity .

What are the optimal expression systems and purification strategies for producing functional recombinant sheep CD1D?

The production of functional recombinant sheep CD1D requires careful consideration of expression systems to ensure proper folding, post-translational modifications, and association with β2-microglobulin. Mammalian expression systems are generally preferred for CD1D production due to the protein's complexity and glycosylation requirements. The mouse plasmacytoma cell line J558L, which has been successfully used for mouse CD1d:Ig fusion protein expression, represents a potential candidate for sheep CD1D expression .

For purification strategies, affinity chromatography using anti-tag antibodies (if the recombinant protein includes a tag) or immunoaffinity chromatography with anti-CD1D antibodies can be employed. Size exclusion chromatography is valuable as a secondary purification step to ensure the isolation of properly folded protein complexes and remove aggregates. Critical quality control steps include verification of β2-microglobulin association, glycosylation status, and functional lipid binding capacity .

It's essential to co-express sheep CD1D with sheep β2-microglobulin to ensure proper folding and assembly of the functional heterodimer. The absence of appropriate β2-microglobulin association can lead to misfolded CD1D with compromised lipid-binding and antigen-presenting capabilities. Additionally, the inclusion of fusion partners like immunoglobulin Fc regions can enhance protein stability and facilitate purification, as demonstrated with mouse CD1d:Ig fusion proteins .

How can researchers validate the functional activity of recombinant sheep CD1D?

Validating functional activity of recombinant sheep CD1D requires multiple complementary approaches. A primary validation method involves lipid binding assays to confirm the protein's ability to load and present glycolipid antigens. This can be accomplished using fluorescently labeled lipids or by detecting changes in protein thermal stability upon lipid binding .

Immunological activity can be assessed through NKT cell activation assays. While sheep-specific NKT cell lines may be limited, researchers can test CD1D-mediated presentation of α-GalCer or other known CD1D ligands to primary sheep lymphocytes and measure activation markers, proliferation, or cytokine production. Cross-reactivity with NKT cells from other species can also provide insights into functional conservation .

Structural validation through techniques such as circular dichroism spectroscopy or limited proteolysis can confirm proper protein folding. Western blot analysis under non-reducing conditions can verify the association with β2-microglobulin, which is essential for functional activity. For mouse CD1d, a specific band at approximately 50 kDa under reducing conditions has been detected, providing a reference point for sheep CD1D molecular weight expectations .

What experimental approaches are effective for studying the interaction between sheep CD1D and NKT cells?

Flow cytometry represents a cornerstone technique for studying sheep CD1D-NKT cell interactions. Recombinant sheep CD1D can be loaded with specific glycolipids, multimerized, fluorescently labeled, and used to detect NKT cells expressing receptors specific for the CD1D-glycolipid complex. DimerX technology, which has been applied to mouse CD1d1, could be adapted for sheep CD1D to create dimeric reagents for enhanced detection sensitivity .

Functional assays measuring NKT cell activation are essential for characterizing these interactions. These include quantifying cytokine production (particularly IFN-γ and IL-4), assessing proliferation, and measuring cytotoxicity against CD1D-expressing target cells. ELISpot assays can provide sensitive detection of responsive cells even when they represent a small population .

Microscopy-based approaches, including confocal microscopy of immunological synapses formed between NKT cells and CD1D-expressing antigen-presenting cells, can yield insights into the spatial and temporal dynamics of these interactions. Additionally, surface plasmon resonance or biolayer interferometry using purified T-cell receptors from NKT cells and recombinant sheep CD1D can provide quantitative binding kinetics data to characterize these molecular interactions .

How do post-translational modifications affect sheep CD1D function and stability?

Post-translational modifications, particularly glycosylation, play crucial roles in CD1D folding, stability, and function. N-linked glycosylation sites in the CD1D extracellular domain contribute to proper protein folding during synthesis and influence protein half-life in circulation. While sheep-specific data is limited, studies with human and mouse CD1D indicate that altered glycosylation can affect trafficking through the endosomal/lysosomal pathway, impacting the repertoire of lipids presented .

The tyrosine-based motif in the CD1D cytoplasmic tail undergoes phosphorylation, which regulates intracellular trafficking and signal transduction. Recent research has shown that CD1D phosphorylation can trigger reverse signaling in antigen-presenting cells, amplifying innate immune responses. Specifically, TLR activation in macrophages can induce phosphorylation of Tyr332 in the CD1D intracellular domain, leading to recruitment and activation of proline-rich tyrosine kinase 2 (Pyk2) .

Ubiquitination likely influences sheep CD1D turnover and trafficking, similar to other transmembrane proteins. Changes in these post-translational modifications under different physiological or pathological conditions may alter CD1D-mediated immune responses. Researchers should consider the impact of expression system choice on post-translational modification patterns when producing recombinant sheep CD1D for functional studies .

What is the optimal protocol for loading glycolipid antigens onto recombinant sheep CD1D?

Loading glycolipid antigens onto recombinant sheep CD1D requires careful consideration of the glycolipid's physicochemical properties and the loading conditions. For water-insoluble glycolipids like α-GalCer, sonication in aqueous buffer containing detergents or incorporation into liposomes facilitates loading. The protocol typically involves incubating recombinant CD1D with the solubilized glycolipid at an approximately 1:3 to 1:10 molar ratio (protein:lipid) for 12-24 hours at 37°C .

For in vitro loading efficiency validation, unbound glycolipids can be removed using size exclusion chromatography or extensive dialysis. If using fluorescently labeled lipids, loading can be quantified by measuring fluorescence associated with the purified protein. Alternatively, mass spectrometry can be employed to detect bound lipids after protein denaturation .

When creating CD1D tetramers or dimers for NKT cell detection, the loading process should be performed before multimerization to ensure maximum loading efficiency. The loaded CD1D multimers can then be tested for their ability to stain NKT cells from sheep peripheral blood or tissues, with unloaded multimers serving as negative controls. Optimization of glycolipid concentration, incubation time, pH, and temperature may be necessary for each specific glycolipid .

How can researchers overcome technical challenges in expressing recombinant sheep CD1D?

One significant challenge in expressing recombinant sheep CD1D is ensuring proper folding and association with β2-microglobulin. Co-expression of sheep β2-microglobulin with CD1D in the chosen expression system is essential. If sheep β2-microglobulin is not available, human or bovine β2-microglobulin can be tested as alternatives, though this may impact functionality .

Low expression yields can be addressed by optimizing codon usage for the expression host, using strong promoters appropriate for the expression system, and screening multiple clones to identify high producers. For mammalian expression systems, adding sodium butyrate can enhance protein production by increasing transcription. Including molecular chaperones as co-expression partners may improve folding efficiency .

Protein aggregation during expression or purification represents another common challenge. This can be mitigated by optimizing buffer conditions, including stabilizing agents like glycerol or specific detergents during purification, and employing gentle purification methods. If the transmembrane domain causes aggregation issues, creating constructs containing only the extracellular domain fused to tags or immunoglobulin domains (similar to the mouse CD1d:Ig fusion approach) can improve solubility while maintaining functional lipid-binding capacity .

What are the key experimental controls required for sheep CD1D-based research?

Rigorous experimental controls are essential for valid interpretation of sheep CD1D research results. For functional studies, unloaded CD1D should serve as a negative control alongside CD1D loaded with irrelevant lipids that are not expected to activate NKT cells. These controls help distinguish specific from non-specific responses in NKT cell activation assays .

When performing binding studies or creating CD1D tetramers, both the complete absence of the glycolipid (empty CD1D) and the presence of the vehicle used to solubilize the glycolipid must be controlled for. Additionally, a non-CD1D protein expressed and purified under identical conditions provides an important control for non-specific protein effects .

For in vivo studies, isotype-matched control proteins are essential when using CD1D-Ig fusion proteins. Species-matching controls are also critical—when studying sheep CD1D, comparison with human or mouse CD1D should be performed with careful consideration of species differences. When analyzing NKT cell responses, conventional T cells from the same source should be examined to confirm the specificity of CD1D-restricted responses .

How can sheep CD1D be utilized in developing novel immunotherapeutic approaches?

Recombinant sheep CD1D loaded with specific glycolipids presents opportunities for developing targeted immunotherapies for sheep diseases. Similar to approaches in human medicine where CD1d-restricted NKT cells have shown anti-tumor and anti-pathogen activity, sheep CD1D-based therapies could activate specific immune responses against infections or cancers in sheep .

Vaccine adjuvant development represents another promising application. CD1D-binding glycolipids like α-GalCer have demonstrated adjuvant properties by activating NKT cells, which subsequently license dendritic cells and enhance adaptive immune responses. Incorporating such glycolipids into sheep vaccines could potentiate protection against challenging pathogens. Research could focus on identifying sheep-specific CD1D ligands that optimally activate sheep NKT cells .

The development of tri-specific antibodies incorporating sheep CD1D domains, similar to the CD1d-Vd2 bsTCE (LAVA-051) being tested in human clinical trials, represents a future direction for targeted immunotherapy in veterinary medicine. Such approaches could redirect immune responses toward specific cell types expressing CD1D ligands. Additionally, understanding sheep CD1D's role in regulating inflammatory responses could inform therapeutic strategies for inflammatory conditions in sheep .

What insights can cross-species CD1D comparisons provide for evolutionary immunology?

Comparative studies of CD1D across species offer valuable insights into the evolution of lipid antigen presentation. The functional conservation of CD1D-NKT cell systems across mammals suggests their important role in host defense. Sheep CD1D research can fill a critical gap in our understanding of this system in ruminants, which diverged from primates and rodents millions of years ago .

Analysis of lipid-binding preferences across species can reveal how CD1D has adapted to species-specific pathogens and lipid environments. Differences in glycolipid presentation efficiency between sheep, human, and mouse CD1D may correlate with species-specific pathogen pressures or metabolic requirements. Such comparative data contributes to our understanding of how innate-like T cell recognition systems evolved .

The genetic organization of CD1 family genes varies across species—mice have two CD1D genes (CD1d1 and CD1d2), while humans, rats, and likely sheep have only one. This genomic diversity reflects evolutionary adaptation and may correlate with functional specialization. Investigating whether sheep possess unique CD1 isoforms or CD1D splice variants could provide insights into ruminant-specific immune adaptations. Additionally, comparing CD1D trafficking mechanisms across species may reveal evolutionary conservation or divergence in antigen processing pathways .

How does sheep CD1D function in hepatic immunity and metabolism?

CD1D expression in hepatocytes and its role in liver immunity and metabolism represent an emerging research area with implications for sheep health. Recent studies in other species have identified decreased CD1D expression in hepatocytes in non-alcoholic steatohepatitis (NASH), suggesting a potential protective role against hepatocyte apoptosis and liver inflammation .

In mouse models, hepatocyte-specific CD1D overexpression protected against hepatocyte apoptosis and alleviated hepatic inflammation and injuries in NASH mice. Mechanistically, anti-CD1D crosslinking on hepatocytes induced tyrosine phosphorylation of the CD1D cytoplasmic tail, leading to JAK2 recruitment and phosphorylation. Phosphorylated JAK2 activated STAT3, subsequently reducing apoptosis in hepatocytes .

These findings have potential relevance for sheep liver diseases and metabolic disorders. Investigating sheep CD1D expression in healthy versus diseased liver could identify similar protective mechanisms. Additionally, the interaction between lipid metabolism and CD1D-mediated immune regulation in sheep liver may provide insights into ruminant-specific metabolic adaptations and disease susceptibilities. This represents an important area for future research with potential implications for treating liver diseases in sheep .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.