Recombinant Sheep ATP synthase protein 8 (MT-ATP8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP8; ATP8; ATPASE8; MTATP8; ATP synthase protein 8; A6L; F-ATPase subunit 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-66
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPELMTTKTPKQNTPWETKWTKIYLPLSLPL
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) synthesizes ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes within the respiratory chain. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked via a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a minor subunit of the F(0) domain, located within the membrane alongside subunit a.
Database Links

KEGG: oas:808253

Protein Families
ATPase protein 8 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is MT-ATP8 and what is its functional role in the ATP synthase complex?

MT-ATP8 is a small, hydrophobic subunit of mitochondrial ATP synthase (Complex V) encoded by the mitochondrial genome. It functions as a critical structural component that provides a physical link between the proton channel and other subunits of the peripheral stalk in the ATP synthase complex . The ATP synthase complex uses the energy created by the proton electrochemical gradient to phosphorylate ADP to ATP, serving as the primary source of cellular ATP production through oxidative phosphorylation .

In terms of structure, MT-ATP8 contains a single transmembrane domain that anchors it in the inner mitochondrial membrane. While its primary sequence is not highly conserved across species, the structural organization and functional role appear to be preserved . Recent structural analyses suggest MT-ATP8 helps stabilize the positioning of subunit a, which is essential for proton translocation .

How is the MT-ATP8 gene organized in the mitochondrial genome of sheep compared to other species?

The MT-ATP8 gene in sheep, like in other mammals, is located in the mitochondrial genome. The gene shows notable organizational features:

SpeciesGene Size (bp)Genome LocationNotable Features
Sheep~207 bpmtDNAOverlaps with MT-ATP6
Human207 bpmtDNA46 nucleotide overlap with MT-ATP6
Bovine207 bpmtDNASimilar organization to human
YeastLargermtDNALess sequence conservation but structural similarity

The MT-ATP8 and MT-ATP6 genes show a 46 nucleotide overlap in humans , and a similar arrangement exists in sheep. This overlapping gene organization creates challenges for studying MT-ATP8 independently, as mutations in the overlapping region can affect both genes simultaneously.

What experimental models are available for studying sheep MT-ATP8 function?

Several experimental models are available for studying MT-ATP8 function, each with specific advantages:

  • Yeast models: Saccharomyces cerevisiae has been successfully used to study the effects of mutations in MT-ATP8. Despite sequence differences between yeast and mammalian ATP8, the structural conservation allows for functional studies . Yeast models permit the introduction of mutations equivalent to those found in human patients to study their effects on ATP synthase function.

  • Transgenic mouse models: Researchers have generated transgenic mice expressing epitope-tagged recoded mitochondrial-targeted ATP8 genes from the nuclear genome . These models allow for the study of allotopic expression approaches and can incorporate sheep MT-ATP8 sequences.

  • Cell culture systems: Both mammalian cell lines and isolated mitochondria preparations can be used to study recombinant MT-ATP8 expression and function.

  • Conplastic mouse models: These models, containing nuclear DNA from one strain and mitochondrial DNA from another, allow researchers to specifically study mitochondrial gene variants without confounding nuclear genetic variations .

What are the recommended methods for expressing recombinant sheep MT-ATP8?

Expressing recombinant MT-ATP8 presents unique challenges due to its mitochondrial origin, hydrophobic nature, and small size. Based on successful approaches with other species, the following methodological approaches are recommended:

  • Targeted genomic integration: For transgenic animal models, targeted integration (e.g., into the ROSA26 locus) using TARGATT homologous recombination technology with ΦC31 integrase and attPx3 docking sites ensures stable expression .

  • Bacterial expression systems: For biochemical studies, E. coli expression systems with fusion partners to enhance solubility can be employed.

  • Cell-free translation systems: These can be combined with lipid nanodiscs for structural studies of the hydrophobic protein.

How can researchers assess the functionality of recombinant sheep MT-ATP8 in experimental systems?

Functional assessment of recombinant MT-ATP8 requires multiple complementary approaches:

  • Integration into ATP synthase complex:

    • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to assess assembly into the ATP synthase complex

    • Co-immunoprecipitation with other ATP synthase subunits

    • Crosslinking studies to verify protein-protein interactions

  • Enzymatic activity measurements:

    • ATP hydrolysis assays using isolated mitochondria

    • In-gel activity staining of ATP synthase following BN-PAGE

    • Oxygen consumption measurements to assess OXPHOS function

    • Membrane potential measurements using fluorescent dyes

  • Structural integration verification:

    • Protease protection assays to confirm proper membrane insertion

    • Sub-mitochondrial fractionation to verify localization

    • Cryo-EM analysis of assembled complexes

  • Complementation studies:

    • Rescue of ATP synthase defects in models with MT-ATP8 mutations

    • Growth rate assessment in yeast models under respiratory conditions

What are the current approaches and challenges for allotopic expression of sheep MT-ATP8?

Allotopic expression (nuclear expression of mitochondrially-encoded genes) represents a promising approach for both studying MT-ATP8 function and potentially developing gene therapies for mitochondrial diseases. Current methodological approaches include:

  • Codon optimization strategies:

    • Replacement of mitochondrial codons with nuclear equivalents

    • Elimination of sequences that might form secondary structures inhibiting translation

    • Balancing GC content for optimal expression

  • Mitochondrial targeting sequence optimization:

    • Selection of effective MTSs: ATP5G1 MTS has been successfully used in mouse models

    • Optimization of MTS cleavage sites

    • Consideration of protein folding during import

  • Genomic integration approaches:

    • Site-directed integration into neutral loci (e.g., ROSA26)

    • Use of strong constitutive promoters (e.g., CAG) for consistent expression

    • Verification of germline transmission through multiple generations

  • Detection and quantification strategies:

    • Epitope tagging (C-terminal MYC and FLAG tags have been successful)

    • Western blotting protocols for small hydrophobic proteins

    • Immunohistochemistry approaches for tissue localization

Challenges specific to MT-ATP8 allotopic expression include:

  • Competition with endogenous mitochondrially-synthesized protein

  • Ensuring proper folding and membrane insertion

  • Achieving sufficient expression levels for functional complementation

  • Tissue-specific expression patterns and requirements

  • Long-term stability of expression in vivo

What is the role of chaperones and assembly factors in the integration of recombinant MT-ATP8?

The proper assembly of MT-ATP8 into the ATP synthase complex involves several chaperones and assembly factors. Recent research has identified:

  • Mitochondrial Hsp70 (mtHsp70) function:

    • mtHsp70 plays a dual role in ATP synthase assembly

    • Cooperates with assembly factors Atp11 and Atp12 to build the F1 domain

    • Functions in the transfer of Atp5 to the INA complex to allow linkage of the F1-domain and peripheral stalk

    • Serves as both an assembly factor and quality control factor for ATP synthase formation

  • Assembly pathway involvement:

    • MT-ATP8 (subunit 8) and MT-ATP6 (subunit a) are typically added at late stages of ATP synthase assembly

    • The assembly process involves multiple modules: the c-ring, F1, and the ATP6/ATP8 complex

    • Expression of subunits 6 and 8 may be translationally regulated by the F1 sector to achieve balanced output between nuclear-encoded and mtDNA-encoded subunits

  • Quality control mechanisms:

    • Mutations in mtHsp70 that impair substrate binding can allow integration of assembly-defective mutants, suggesting a role in preventing incorporation of defective components

    • The peripheral stalk, which interacts with MT-ATP8, is important for the stability of the c-ring/F1 complex

Understanding these chaperone interactions is critical for optimizing recombinant MT-ATP8 expression and integration, particularly in heterologous systems or when studying disease-associated variants.

What are the most promising future directions for recombinant sheep MT-ATP8 research?

Based on current research trends and technological developments, several promising directions emerge:

  • Advanced structural biology approaches combining cryo-EM with mass spectrometry to resolve species-specific details of MT-ATP8 integration into ATP synthase

  • Comprehensive mutational analysis using recombinant expression systems to map structure-function relationships specific to sheep MT-ATP8

  • Development of sheep-specific disease models to study naturally occurring MT-ATP8 variants in the appropriate genetic context

  • Integration of multi-omics approaches to understand MT-ATP8 function in the broader context of mitochondrial biology and energy metabolism

  • Exploration of allotopic expression approaches as both research tools and potential therapeutic strategies for mitochondrial diseases affecting ATP synthase function

The continued development of these research avenues will enhance our understanding of this small but critical component of the cellular energy production machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.