Recombinant Sheep ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

The MT-ATP6 protein forms part of the F<sub>O</sub> domain of ATP synthase, which facilitates proton translocation across the mitochondrial inner membrane. Key features include:

  • Subunit Composition: In mammals, ATP synthase comprises 16–18 subunits. MT-ATP6 (subunit a) and MT-ATP8 (subunit A6L) are the only mtDNA-encoded subunits .

  • Role in Proton Channeling: MT-ATP6 directly participates in proton transport, enabling the rotational catalysis that converts ADP to ATP . The protein’s hydrophobic structure embeds it within the membrane, where it interacts with the c-ring to drive ATP synthesis .

Table 1: Comparative Subunit Composition of ATP Synthase Across Species

SpeciesmtDNA-encoded SubunitsNuclear DNA-encoded SubunitsKey Assembly Factors
HumanMT-ATP6, MT-ATP8ATP5F1, ATP5G1, etc.mtHsp70, Atp11/12
BovineMT-ATP6, MT-ATP8Similar to humanmtHsp70
E. coliSubunit a (analogous)b, δ, α, β, γ, εNot applicable

Recombinant Production and Challenges

Recombinant MT-ATP6 is typically produced using heterologous expression systems (e.g., E. coli or yeast) due to challenges in mitochondrial protein folding and membrane integration. Key findings from related studies:

  • Assembly Dependence: The mitochondrial Hsp70 (mtHsp70) chaperone system is essential for folding and integrating MT-ATP6 into ATP synthase. Mutations in mtHsp70 (e.g., ssc1-62 in yeast) disrupt subunit assembly, leading to defective ATP synthase activity .

  • Quality Control: Unassembled MT-ATP6 subunits are degraded via the Pim1 protease, highlighting the need for precise stoichiometric balance during recombinant production .

Table 2: Functional Impact of MT-ATP6 Variants in Human Studies

VariantBiochemical DefectClinical PhenotypeSource
m.8993T>GReduced ATP synthesis, ↑ membrane potentialLeigh syndrome, NARP
m.9185T>CImpaired proton pumping, ↓ ATP hydrolysisAtaxia, neuropathy
m.9176T>GAltered rotor efficiencySpastic paraplegia

Research Applications and Insights

  • Disease Modeling: Pathogenic MT-ATP6 variants (e.g., m.8993T>G) are linked to neurodegenerative disorders like NARP and Leigh syndrome. Recombinant MT-ATP6 enables mechanistic studies of these variants .

  • Structural Studies: Cryo-EM and X-ray crystallography of bovine MT-ATP6 (UniProt: P00847) have elucidated proton channel dynamics, informing drug design for mitochondrial diseases .

Current Limitations and Future Directions

  • Species-Specific Data: While bovine and human MT-ATP6 structures are well-characterized, sheep-specific recombinant studies remain sparse. Cross-species homology (e.g., 98% amino acid similarity between bovine and sheep MT-ATP6) supports extrapolation .

  • Functional Assays: Standardized biochemical tests (e.g., ATP synthesis rates, membrane potential assays) are needed to validate recombinant MT-ATP6 activity .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MNENLFASFITPMMFGLPLVTLIVLFPSLLFPTSNRLVNNRLISLQQWMLQLVSKQMMSI HNTKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWGGAVITGFRNK TKASLAHFLPQGTPTPLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLA LMSINTTTALITFIILILLTVLEFAVAMIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for generating ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and likely plays a direct role in proton translocation across the membrane.
Database Links

KEGG: oas:808254

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MT-ATP6 in sheep mitochondria?

MT-ATP6 forms a critical component of ATP synthase (Complex V) in the inner mitochondrial membrane. This protein constitutes part of the F₀ domain, which creates a proton channel through the membrane. The proton flow through this channel drives the conformational changes in the F₁ domain that catalyze ATP synthesis from ADP.

In sheep, as in other mammals, MT-ATP6 is encoded by the mitochondrial genome. The protein works in concert with other subunits, particularly subunit A6L (encoded by MT-ATP8), to form a functional proton channel. The flow of protons through this channel provides the energy necessary for ATP synthesis from ADP in the mitochondrial matrix .

Methodologically, researchers investigating the structure typically employ techniques such as X-ray crystallography, cryo-electron microscopy, or comparative modeling based on better-characterized bovine complex V structures .

How does sheep MT-ATP6 differ from other mammalian homologs?

While the core function of MT-ATP6 is conserved across mammals, species-specific variations exist. Sheep MT-ATP6 shares high sequence homology with bovine MT-ATP6, making bovine models useful for comparative studies. Important functional domains, including transmembrane regions and proton-conducting residues, are highly conserved.

When conducting cross-species analyses, researchers should focus on:

  • Sequence alignment of conserved functional domains

  • Species-specific post-translational modifications

  • Interaction patterns with other complex V subunits

  • Variable regions that might affect antibody recognition in immunological assays

Comparison studies between sheep and human MT-ATP6 can provide valuable insights for modeling human mitochondrial disorders, as pathogenic mutations often affect conserved residues across species .

What expression systems are most suitable for recombinant sheep MT-ATP6 production?

Producing recombinant MT-ATP6 presents significant challenges due to its hydrophobic nature and mitochondrial origin. The most effective approaches include:

  • Bacterial expression systems: Using E. coli with specialized strains optimized for membrane protein expression, often with fusion tags to enhance solubility.

  • Yeast systems: S. cerevisiae or P. pastoris can provide a eukaryotic environment with proper membrane insertion machinery.

  • Mammalian cell lines: For applications requiring native-like post-translational modifications and protein folding.

  • Cell-free expression systems: Useful for avoiding toxicity issues associated with membrane protein overexpression.

When designing expression constructs, researchers should consider including the full mitochondrial targeting sequence for subsequent purification and functional studies . The complex structure of ATP synthase often necessitates co-expression with other subunits for proper folding and stability.

How can researchers effectively study the assembly of recombinant sheep MT-ATP6 into functional ATP synthase complexes?

Studying MT-ATP6 assembly requires sophisticated methodological approaches. The most effective protocol combines:

  • Blue-native gel electrophoresis (BN-PAGE): This technique separates intact protein complexes while preserving their native states. When analyzing recombinant sheep MT-ATP6 integration, researchers should look for multiple bands representing various assembly intermediates. Complete assembly results in a ~550 kDa complex, while partial assembly often appears as smaller complexes (~450 kDa) .

  • Two-dimensional electrophoresis: Combining BN-PAGE with SDS-PAGE in the second dimension allows for the identification of specific subunits within each complex.

  • Immunoprecipitation with antibodies: Against other ATP synthase subunits to confirm integration.

  • Transmitochondrial cybrid cell studies: When investigating mutations, creating cybrid cells with varying heteroplasmy levels provides valuable insights into assembly efficiency under pathological conditions .

The assembly process follows a specific pathway: c-ring formation, followed by F₁ attachment, stator arm binding, and finally incorporation of subunits a (MT-ATP6) and A6L. This pattern must be considered when designing experiments to track recombinant protein incorporation .

What are the most reliable methods for assessing the functional impact of sheep MT-ATP6 mutations?

Functional assessment of MT-ATP6 mutations requires a multi-parameter approach:

  • Microscale oxygraphy: Using platforms like Seahorse XF or Oroboros to measure:

    • Basal respiration rates

    • ATP synthesis capacity

    • Maximal respiratory capacity

    • Proton leak

  • Membrane potential measurement: Using fluorescent probes (TMRM, JC-1) to assess if mutations affect the proton gradient.

  • ATP production assays: Luminescence-based quantification of ATP synthesis rates.

  • Reactive oxygen species (ROS) measurement: Mutations often increase ROS production, which can be measured using specific fluorescent probes .

  • Enzyme activity assays: Specifically measuring complex V activity using spectrophotometric methods.

When interpreting results, researchers should establish heteroplasmy thresholds (percentage of mutant mtDNA) at which biochemical defects become apparent. This typically requires creating models with varying heteroplasmy levels .

How does heteroplasmy of MT-ATP6 mutations affect experimental design when studying recombinant protein function?

MT-ATP6 mutations exhibit tissue-specific heteroplasmy (varying proportions of mutant mtDNA), which significantly impacts experimental design. Researchers should consider:

  • Multiple tissue sampling: Heteroplasmy levels can vary dramatically between tissues (blood, muscle, fibroblasts, etc.).

  • Single-cell analysis: Even within tissues, cell-to-cell variation occurs.

  • Threshold effects: Most MT-ATP6 mutations only cause biochemical defects when heteroplasmy exceeds a certain threshold (typically 60-90%).

  • Creation of controlled heteroplasmy models: Using cybrid cell technology to create cells with defined heteroplasmy levels.

Data from studies on truncating MT-ATP6 mutations show heteroplasmy can range from <10% to >90% across different tissues in the same individual . This variability necessitates careful experimental design, particularly when correlating biochemical findings with clinical phenotypes.

A comprehensive experimental approach should include Blue-native gel electrophoresis of samples with varying heteroplasmy to visualize the impact on complex V assembly, coupled with functional assays at each heteroplasmy level .

How can recombinant sheep MT-ATP6 be used to model human mitochondrial diseases?

Recombinant sheep MT-ATP6 provides a valuable platform for modeling human mitochondrial diseases due to several key advantages:

  • Homology to human protein: The conserved functional domains between sheep and human MT-ATP6 allow investigation of disease-causing mutations at analogous positions.

  • Integration into functional studies: By introducing recombinant sheep MT-ATP6 carrying specific mutations into:

    • Isolated mitochondrial preparations

    • Reconstituted liposome systems

    • Cultured cell models

  • Disease-specific mutation modeling: Several human diseases associated with MT-ATP6 mutations can be modeled:

    • Leigh syndrome (affects approximately 10% of cases)

    • NARP (Neurogenic muscle weakness, Ataxia, and Retinitis Pigmentosa)

    • MILS (Maternally Inherited Leigh Syndrome)

    • Cerebellar ataxia with renal disease

Methodologically, researchers should use site-directed mutagenesis to introduce specific mutations into the recombinant sheep MT-ATP6 gene before expression. The most common pathogenic mutation, T8993G, which replaces a highly conserved leucine with arginine, disrupts proton flow through the F₀ sector .

What methods can assess the impact of MT-ATP6 mutations on mitochondrial morphology and dynamics?

MT-ATP6 mutations not only affect ATP production but also influence mitochondrial morphology and dynamics. Assessment requires:

  • Confocal microscopy with mitochondrial dyes: To visualize changes in:

    • Mitochondrial network structure

    • Fragmentation patterns

    • Distribution within cells

  • Electron microscopy: For ultrastructural analysis of:

    • Cristae morphology

    • Mitochondrial size and shape

    • Membrane integrity

  • Live-cell imaging: To track dynamic processes like:

    • Fusion and fission events

    • Mitochondrial transport

    • Response to metabolic stress

  • Quantitative image analysis: Using specialized software to measure:

    • Network complexity

    • Mitochondrial size distribution

    • Branching patterns

What are the most promising approaches for analyzing the interaction between recombinant MT-ATP6 and other ATP synthase subunits?

Analyzing protein-protein interactions involving MT-ATP6 requires specialized techniques due to the hydrophobic nature of this protein:

  • Crosslinking mass spectrometry (XL-MS): This technique can capture transient interactions between MT-ATP6 and other subunits, particularly important for understanding assembly intermediates.

  • Co-immunoprecipitation with membrane solubilization: Using mild detergents that preserve protein-protein interactions while solubilizing membrane proteins.

  • Förster Resonance Energy Transfer (FRET): By tagging MT-ATP6 and potential interaction partners with appropriate fluorophores.

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics between purified components.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions involved in subunit interactions.

Research has shown that MT-ATP6 interacts directly with subunit A6L, providing a physical link between the proton channel and other peripheral stalk subunits . The interface between subunit a (MT-ATP6) and the c-ring is particularly important as it forms the proton-translocating pathway essential for ATP synthesis.

What quality control measures are essential when working with recombinant sheep MT-ATP6?

Quality control is particularly important for highly hydrophobic membrane proteins like MT-ATP6:

  • Protein purity assessment:

    • SDS-PAGE with Coomassie or silver staining

    • Western blotting with specific antibodies

    • Mass spectrometry verification of protein identity

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Tryptophan fluorescence to assess tertiary structure

    • Limited proteolysis to evaluate folding quality

  • Functional validation:

    • Reconstitution into liposomes to test proton translocation

    • Assembly with other purified subunits

    • ATP hydrolysis/synthesis activity measurements

  • Stability assessment:

    • Thermal shift assays adapted for membrane proteins

    • Long-term storage stability at different temperatures

    • Resistance to aggregation under experimental conditions

When interpreting results, researchers should compare recombinant protein behavior with native protein from mitochondrial preparations to ensure physiological relevance .

How can researchers effectively address the challenges of MT-ATP6 antibody specificity and sensitivity?

Developing and validating antibodies against MT-ATP6 presents unique challenges due to its hydrophobic nature and mitochondrial localization:

  • Epitope selection strategy:

    • Target hydrophilic loops exposed to the mitochondrial matrix

    • Avoid transmembrane segments unless using denatured samples

    • Consider species-specific variations when using commercial antibodies

  • Validation requirements:

    • Positive controls using isolated mitochondria

    • Negative controls using tissues from knockout models or siRNA knockdown

    • Peptide competition assays to confirm specificity

    • Western blotting under denaturing and native conditions

  • Application-specific considerations:

    • For immunohistochemistry: optimize fixation to preserve epitope accessibility

    • For immunoprecipitation: use detergents that maintain tertiary structure

    • For flow cytometry: ensure cell permeabilization reaches mitochondria

When publishing results, researchers should thoroughly document antibody validation steps according to current reporting guidelines for antibody-based research .

What considerations are important when designing experiments to study MT-ATP6 mutation heteroplasmy?

The variable distribution of mutant and wild-type mtDNA (heteroplasmy) significantly impacts MT-ATP6 research design:

  • Accurate heteroplasmy quantification methods:

    • Pyrosequencing for precise percentage determination

    • Next-generation sequencing for detecting low-level heteroplasmy

    • Digital droplet PCR for absolute quantification

    • Single-cell analysis to detect cellular mosaicism

  • Multiple tissue sampling strategy:

    • Collect samples from tissues with different metabolic demands

    • Consider developmental changes in heteroplasmy patterns

    • Include post-mitotic (muscle, brain) and mitotic tissues (blood, fibroblasts)

  • Threshold effect determination:

    • Create models with controlled heteroplasmy levels

    • Establish biochemical and physiological thresholds for dysfunction

    • Correlate heteroplasmy with phenotypic severity

Research shows that truncating MT-ATP6 mutations exhibit highly variable heteroplasmy across different tissues, ranging from <10% to >90% . This variability must be accounted for when designing experiments and interpreting results from different model systems or patient samples.

How can sheep MT-ATP6 research contribute to understanding mitochondrial disease mechanisms beyond energy production?

MT-ATP6 research extends beyond basic bioenergetics to several emerging areas:

  • Mitochondrial calcium handling: ATP synthase components, including MT-ATP6, may participate in calcium uptake through the mitochondrial permeability transition pore, affecting cell death pathways.

  • Mitochondrial-nuclear communication: MT-ATP6 mutations trigger retrograde signaling that alters nuclear gene expression, representing an important adaptive mechanism.

  • Mitochondrial dynamics regulation: Research suggests ATP synthase dimerization, which involves MT-ATP6, influences cristae morphology and mitochondrial fusion/fission balance.

  • Tissue-specific vulnerability patterns: Different tissues show varying thresholds for MT-ATP6 mutation effects, with brain, kidney, and muscle particularly susceptible .

Emerging methodologies for investigating these processes include spatially-resolved metabolomics, in situ cryo-electron tomography, and live-cell imaging with genetically-encoded sensors for mitochondrial function.

What are the implications of MT-ATP6 research for understanding related neurodegenerative diseases?

MT-ATP6 research provides valuable insights into several neurodegenerative conditions:

  • Leigh syndrome: MT-ATP6 mutations account for approximately 10% of Leigh syndrome cases, characterized by progressive brain disorder with developmental delay, movement problems, and respiratory difficulties .

  • Cerebellar ataxias: Recent findings have expanded the clinical spectrum of MT-ATP6-related disorders to include various forms of cerebellar ataxia, sometimes associated with myoclonic epilepsy .

  • Leukodystrophy and white matter diseases: MT-ATP6 mutations have been linked to posterior white matter abnormalities and cognitive decline .

  • Renal disease connections: Emerging evidence suggests MT-ATP6 mutations can cause chronic kidney disease requiring transplantation, expanding the clinical spectrum beyond the nervous system .

  • Ceroid lipofuscinosis links: Research in sheep has investigated potential connections between ATP synthase components and ceroid lipofuscinosis, although direct causal links with MT-ATP6 have not been established .

These findings highlight the importance of comprehensive phenotyping in mitochondrial disease research and suggest shared pathophysiological mechanisms across seemingly distinct disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.