Recombinant Sheep Beta-1 adrenergic receptor (ADRB1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant sheep ADRB1 is synthesized using E. coli expression systems. Key parameters include:

ParameterDetails
Expression VectorpET or pGEX systems for high-yield protein production .
TaggingTags (e.g., His, GST) added during manufacturing for purification .
Purity>85% confirmed via SDS-PAGE .
StorageLyophilized form stable for 12 months at -20°C/-80°C .

A. Functional Assays

  • Radioligand Binding: Membranes expressing recombinant ADRB1 are used to study ligand affinity (e.g., sotalol, propranolol) .

  • GTPγS Binding: Measures G-protein activation upon receptor stimulation .

B. Key Interactions

ADRB1 engages in diverse biochemical interactions :

FunctionPartner Proteins/Pathways
Ras ActivationGs-alpha/cAMP-mediated signaling .
Calcium SignalingPLC-IP3 pathways via Gq/11 proteins .
Beta-Arrestin RecruitmentMAPK pathway activation .

A. Cardiovascular Studies

  • Mechanistic Insights: Used to model heart failure and arrhythmias by studying ADRB1’s role in cardiac contractility .

  • Drug Screening: Evaluates β-blockers (e.g., propranolol) for therapeutic efficacy .

B. Circadian Rhythm Regulation

ADRB1 in the dorsal pons modulates wakefulness and REM sleep, as shown in murine models . Recombinant ADRB1 aids in mapping neuronal circuits involved in sleep disorders .

Available Reagents

Commercial suppliers offer tools for ADRB1 research :

Product TypeExamplesApplications
AntibodiesCSB-PA000937 (Cusabio)WB, IHC, ELISA .
siRNAMISSION® esiRNA (Sigma-Aldrich)Gene silencing .
Recombinant ProteinCSB-EP630703SH1 (Cusabio)Binding assays .

Handling and Stability

  • Reconstitution: Use deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Stability:

    • Liquid form: 6 months at -20°C .

    • Avoid repeated freeze-thaw cycles .

Future Directions

  • Therapeutic Targeting: ADRB1 polymorphisms (e.g., Gly389Arg) influence drug responses in hypertension and heart failure .

  • Neuroscience: Role in noradrenaline-mediated circadian synchronization warrants further study .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling special format requests. Please specify any format preferences in your order notes, and we will do our best to accommodate your needs.
Lead Time
Delivery times may vary based on the purchase method and location. We recommend consulting your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. To ensure product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
ADRB1; BAR1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; BETA1AR; Beta-1 adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-467
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MGAGALALGASEPCNLSFAAPVPDGAATAARLLVPXSPLRLAADLGQRGTPLLSQQWTVG MGLLMAFIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVC TVWAISALVSFLPIFMQWWGDKDAKASRCYNDPECCDFIINEGYAITSSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLSGPARLPSPALSPGAPLPAAAVANGRANKRRPSR LVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFN PIIYCRSPDFRKAFQRLLCCARRAACGSHGAAGDPPRAAGCLAVARPSPSPGAASDDDDD DDEDDVGAAPPVRLLQPWAGYNGGAAANSDSSPDEPSRPGCGSESKV
Uniprot No.

Target Background

Function
Beta-adrenergic receptors facilitate the activation of adenylate cyclase by catecholamines via the action of G proteins. This receptor binds epinephrine and norepinephrine with near equal affinity. It mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling and plays a role in regulating sleep/wake behaviors.
Database Links

UniGene: Oar.519

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.

Q&A

What is the primary function of Beta-1 adrenergic receptor (ADRB1)?

Beta-1 adrenergic receptors mediate catecholamine-induced activation of adenylate cyclase through G proteins. These receptors bind epinephrine and norepinephrine with approximately equal affinity and play crucial roles in mediating Ras activation through G(s)-alpha and cAMP-mediated signaling pathways. ADRB1 also plays a significant role in the fight-or-flight response, coordinating with other adrenergic receptors such as beta-2 adrenergic receptor to ensure a well-rounded physiological reaction to stressors . Recent research has also identified ADRB1's involvement in the regulation of sleep/wake behaviors .

How conserved is sheep ADRB1 compared to human and mouse orthologs?

While sheep-specific ADRB1 data is limited in the provided search results, adrenergic receptors generally show strong evolutionary conservation across mammalian species. Researchers should note that despite this conservation, species-specific differences in post-translational modifications, particularly glycosylation patterns, can affect receptor function and molecular weight. For instance, mouse ADRB1 contains potential glycosylation sites that explain why it migrates at a higher molecular weight (55 kDa) than the predicted size (51 kDa) in Western blot analyses . When working with sheep ADRB1, researchers should verify sequence homology with human and mouse models while accounting for potential species-specific post-translational modifications.

What are the common cellular signaling pathways associated with ADRB1?

ADRB1 primarily signals through the G protein-coupled pathway, activating adenylate cyclase to increase intracellular cAMP levels. This triggers downstream signaling cascades involving protein kinase A (PKA). Research has shown that ADRB1 mediates Ras activation through G(s)-alpha and cAMP-mediated signaling . Mutations in ADRB1, such as the A187V mutation identified in humans with natural short sleep patterns, can alter cAMP production in response to agonists like isoproterenol, demonstrating the critical role of this pathway in ADRB1 function . When studying recombinant sheep ADRB1, researchers should design experiments that monitor cAMP production as a primary readout of receptor functionality.

What techniques are effective for detecting recombinant ADRB1 expression in heterologous systems?

Multiple approaches can be employed to detect ADRB1 expression. Western blotting with specific antibodies has proven reliable, typically requiring 1-5 μg/mL of antibody concentration depending on the source material . Immunocytochemistry/immunofluorescence (ICC/IF) techniques are effective for visualizing cellular localization, where protocols using methanol fixation (100%, 5 minutes), followed by PBS-Tween (0.1%) permeabilization and BSA/normal serum blocking have shown good results . When designing these experiments, researchers should include proper controls and may consider dual-labeling with structural markers like alpha-tubulin to confirm subcellular localization.

How can I monitor the activity of ADRB1-expressing neurons in vivo?

Calcium imaging using fiber photometry has proven highly effective for monitoring ADRB1 neuronal activity in freely moving animals. This approach involves injecting a Cre-dependent AAV encoding fluorescent calcium indicators (such as GCaMP6s) into regions expressing ADRB1, followed by implantation of fiber optic probes for light delivery and fluorescence detection . Simultaneous EEG/EMG recordings allow correlation of neuronal activity with specific behavioral states. This method has successfully revealed that ADRB1-positive neurons in the dorsal pons are predominantly wake- and REM sleep-active . Researchers working with sheep models could adapt these techniques with appropriate stereotaxic coordinates for targeted brain regions.

What sequencing approaches are recommended for studying ADRB1 gene variants?

Long-read sequencing technologies, such as Oxford Nanopore's MinION platform, have been successfully employed to investigate ADRB1 gene variants. The sequencing methodology involves DNA extraction, PCR amplification using specific primers (for ADRB1: forward 5′-AGACGTGCTATGTGTGACGG-3′ and reverse 5′-AGCACTTGGGGGTCGTTGTAG-3′), followed by library preparation (using kits like SQK-LSK109) and sequencing on appropriate flow cells (such as FLO-MIN106) . Bioinformatics analysis typically includes basecalling, demultiplexing, and mapping to reference sequences. This approach has demonstrated high coverage and accuracy for ADRB1 regions with aligned read numbers reaching well over 100,000 per sample in published studies .

How do mutations in ADRB1 affect receptor function and physiological outcomes?

Mutations in ADRB1 can significantly alter receptor function with profound physiological consequences. Research on the A187V mutation found in human subjects with natural short sleep patterns demonstrated decreased cAMP production in response to isoproterenol treatment compared to wild-type receptors . When this mutation was engineered into mice, it resulted in approximately 55 minutes less sleep within a 24-hour period, specifically in the dark phase, affecting both NREM and REM sleep primarily through reduction in sleep bout numbers rather than episode duration . These mutant mice accumulated more sleep pressure, as evidenced by higher delta power at the beginning of the light phase (ZT1-2) . When investigating sheep ADRB1 variants, researchers should consider functional assays measuring cAMP production along with downstream physiological outcomes specific to the system under study.

What is the neuroanatomical distribution of ADRB1-expressing cells and how does this relate to function?

ADRB1 is expressed at high levels in specific brain regions, particularly the dorsal pons (DP). Characterization of these neurons has revealed that ADRB1-positive cells in the DP are predominantly glutamatergic (~37%) or GABAergic (~25%), with very few cholinergic or noradrenergic cells . This neurochemical profile provides insight into how these neurons integrate into broader neural circuits. Calcium imaging studies have demonstrated that these ADRB1-positive neurons are primarily active during wakefulness and REM sleep, and experimental manipulation of their activity directly affects sleep/wake patterns . This suggests a critical role for ADRB1-expressing neurons in sleep regulation. Researchers working with sheep models should consider similar neuroanatomical mapping approaches to establish species-specific distribution patterns.

How does ADRB1 interact with other adrenergic receptors in coordinating physiological responses?

ADRB1 functions in concert with other adrenergic receptors, particularly beta-2 adrenergic receptor (ADRB2), to coordinate physiological responses to stress and other stimuli . This coordination is essential for a well-rounded fight-or-flight response. Studies investigating both ADRB1 and ADRB2 have employed similar methodological approaches, though detection sensitivity may vary significantly between the two receptor subtypes as demonstrated by sequencing studies showing much higher aligned read numbers for ADRB1 compared to ADRB2 . Understanding these receptor interactions requires comprehensive experimental designs that can simultaneously monitor multiple receptor subtypes and their downstream effectors.

How should researchers address variability in ADRB1 expression levels across different tissues or experimental conditions?

Variability in ADRB1 expression presents significant challenges for data interpretation. Researchers should implement robust normalization strategies, including the use of multiple housekeeping genes as references and consider tissue-specific controls. When analyzing fiber photometry data from ADRB1-expressing neurons, for example, researchers have addressed variability by comparing relative signal amplitude between active and sleep phases within the same animal rather than directly comparing absolute values between different animals . This approach controls for variations in virus expression levels around optical fiber tips. For protein-level analyses using Western blotting, consistent loading controls and careful quantification methods are essential for reliable comparisons.

What statistical approaches are recommended for analyzing ADRB1 sequencing data?

Analysis of ADRB1 sequencing data requires rigorous statistical methods to identify significant variants. For long-read sequencing approaches, quality filtering based on sequence scores is an essential first step before mapping to reference sequences . Coverage metrics are critical for assessing reliability, with studies showing successful analyses achieving >100,000 aligned reads for ADRB1 regions . As demonstrated in the table below from published research, coverage can vary significantly across samples:

BarcodeReceived data size (MB fastq/barcode)ADRB1 Aligned Read number
NBD01137137701
NBD02183165975
NBD039587236
NBD04168156156
NBD058896652

Bioinformatics tools like Geneious Prime and validation through platforms such as VarSome Tools enhance the reliability of variant detection . For comparing variant frequencies between experimental groups, chi-square or Fisher's exact tests are typically employed, with appropriate corrections for multiple testing.

How can researchers distinguish between direct effects of ADRB1 manipulation and secondary circuit-level changes?

Distinguishing direct cellular effects from circuit-level consequences presents a significant challenge in ADRB1 research. When examining changes in neuronal activity following genetic manipulation of ADRB1 (such as the A187V mutation), researchers have observed that mutant mice exhibited a 34% increase in fluorescence signal while spending only 9% more time in wakefulness, suggesting that the change could not be solely attributed to altered behavior . To address this challenge, researchers have employed acute isolated tissue preparations for single-cell imaging, effectively removing circuit-level influences. Complementary approaches include pharmacological interventions with specific agonists or antagonists, designer receptors exclusively activated by designer drugs (DREADDs), and temporally precise optogenetic manipulations that can help dissect direct receptor effects from downstream network consequences.

What are emerging applications of ADRB1 research in sleep medicine?

Recent discoveries linking ADRB1 mutations to natural short sleep patterns have opened new avenues for sleep medicine research. The identification of the A187V mutation in human subjects with familial natural short sleep and subsequent validation in mouse models has established ADRB1 as a critical regulator of sleep/wake behaviors . Current research focuses on understanding how ADRB1-expressing neurons in the dorsal pons regulate sleep architecture through their primarily wake-active and REM sleep-active patterns . Future directions may include developing targeted therapeutics that modulate ADRB1 signaling to address sleep disorders without the side effects associated with current medications. Researchers working with sheep models might consider investigating breed-specific sleep patterns in relation to ADRB1 variants as a translational approach.

How is ADRB1 research contributing to understanding cardiac conditions like Takotsubo Syndrome?

ADRB1 research has provided insights into cardiac conditions such as Takotsubo Syndrome, a stress-induced cardiomyopathy. Studies comparing ADRB1 gene expression between Takotsubo patients and healthy controls have employed comprehensive genomic analyses focusing on structural variations . While no structural variations in ADRB1 leading to Takotsubo Cardiomyopathy were detected in one study, the methodology established—involving DNA extraction, specific primer designs, and long-read sequencing—provides a robust framework for future investigations . Ongoing research continues to explore how adrenergic signaling contributes to stress-induced cardiac dysfunction, with potential implications for targeted therapeutic approaches.

What technological advances are improving our ability to study ADRB1 function in complex physiological systems?

Technological innovations have significantly enhanced ADRB1 research capabilities. Fiber photometry combined with genetically encoded calcium indicators now allows for real-time monitoring of ADRB1-expressing neuronal activity in freely moving animals, correlating cellular activity with behavioral states . CRISPR/Cas9 gene editing has enabled precise introduction of specific mutations, such as the A187V variant, facilitating direct assessment of functional consequences in animal models . Advanced sequencing technologies, including long-read approaches using platforms like Oxford Nanopore's MinION, provide comprehensive coverage of ADRB1 genetic variations with high accuracy . Future directions may include single-cell transcriptomics to characterize ADRB1-expressing cell populations with unprecedented resolution and the development of more selective pharmacological tools to probe receptor function in specific tissues or cell types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.