Recombinant Sheep Corticotropin-releasing factor receptor 1 (CRHR1)

Shipped with Ice Packs
In Stock

Description

Molecular Overview and Production

Recombinant Sheep CRHR1 is synthesized in E. coli systems, yielding a 415-amino acid protein (residues 24–415) with an N-terminal His-tag for purification . Key specifications include:

PropertyDetail
UniProt IDO62772
Molecular Weight~45–50 kDa (glycosylation-dependent)
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); -80°C stable
ReconstitutionDeionized water + 50% glycerol recommended for long-term storage

The protein retains functional ligand-binding domains, enabling interaction with corticotropin-releasing hormone (CRH) and related peptides .

Ligand Binding and Signaling

  • CRHR1 binds CRH with high affinity, initiating cAMP-dependent pathways that regulate ACTH secretion .

  • Structural studies of human CRHR1’s extracellular domain (ECD) reveal a conserved α-β-βα fold, though sheep CRHR1 exhibits a truncated N-terminal helix compared to human orthologs .

Role in Neural Development

  • CRHR1 activation enhances neural stem cell self-renewal via the CREB/REST pathway, delaying neuronal differentiation in embryonic models .

  • Knockdown experiments show increased βIII-tubulin expression (neuronal marker), confirming CRHR1’s role in maintaining stemness .

In Vitro Studies

  • ACTH Secretion Assays: Used to evaluate CRHBP’s inhibitory effects on CRHR1-mediated ACTH release in pituitary cells .

  • Ligand Screening: Serves as a target for identifying CRHR1 antagonists with potential therapeutic applications in anxiety and depression .

  • Activity Validation: Functional assays (e.g., cAMP accumulation) confirm receptor activation post-reconstitution .

  • Storage Stability: Repeated freeze-thaw cycles degrade activity; single-use aliquots are advised .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
CRHR1; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1; Corticotropin-releasing hormone receptor 1; CRH-R-1; CRH-R1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-415
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
SLQDQHCESLSLASNVSGLQCNASVDLNGTCWPQSPAGQLVVRPCLVFFYGVRYNTTSNG YRVCLANGTWAARVNHSECQEILSEGEKSKAHYHIAVIINYLGHCISLAALLVAFVLFLR LRSIRCVRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAVVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Uniprot No.

Target Background

Function
The Corticotropin-releasing factor receptor 1 (CRHR1) is a G-protein coupled receptor responsible for binding Corticotropin-releasing factor (CRH) and Urocortin (UCN). It exhibits high affinity for both ligands. Ligand binding triggers a conformational change, initiating signaling via guanine nucleotide-binding proteins (G proteins) and downstream effectors, such as adenylate cyclase. CRHR1 activation stimulates adenylate cyclase, leading to increased intracellular cAMP levels. It also inhibits the activity of the calcium channel CACNA1H. This receptor is essential for normal embryonic development of the adrenal gland and for appropriate hormonal responses to stress. Additionally, it plays a crucial role in the response to anxiogenic stimuli.
Database Links

KEGG: oas:443025

UniGene: Oar.759

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Note=Agonist-binding promotes endocytosis.

Q&A

What is the molecular structure of sheep CRHR1?

Sheep CRHR1 is a seven-transmembrane helix, G-protein-coupled receptor encoded by a 1245 bp open reading frame that translates to a 415 amino acid protein . The receptor belongs to the GPCR superfamily and shares significant homology with CRHR1 from other species: 95% with human, 94% with mouse/rat, 86% with chicken, and 78% with xenopus CRHR1 . Structurally, the receptor contains an extracellular N-terminal domain responsible for ligand binding, seven transmembrane domains that anchor the receptor in the cell membrane, and a cytoplasmic tail region critical for signal transduction and receptor internalization.

How does sheep CRHR1 function in the neuroendocrine system?

CRHR1 serves as the primary receptor for corticotropin-releasing hormone (CRH) and also binds urocortin (UCN) with high affinity . Upon ligand binding, the receptor undergoes a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins) . This activation primarily leads to:

  • Promotion of adenylate cyclase activity, resulting in increased intracellular cAMP levels

  • Inhibition of the calcium channel CACNA1H

  • Initiation of downstream signaling cascades affecting stress responses

CRHR1 is required for normal embryonic development of the adrenal gland and for appropriate hormonal responses to stress . The receptor plays a critical role in mediating anxiogenic responses and coordinating the body's physiological adaptation to stressors.

What are the key differences between sheep CRHR1 and human/rodent CRHR1?

While sheep CRHR1 shares 95% homology with human CRHR1, there are notable differences :

Species ComparisonSequence IdentityKey Distinctions
Sheep vs. Human95% homologySheep CRHR1 shows selectivity for ovine CRF compared to human/rat CRF
Sheep vs. Rat94% homologyDifferences in binding affinity and downstream signaling efficiency
Ovine CRF vs. Human/Rat CRF84% identityStructural variations affecting receptor binding properties

These differences may impact experimental design considerations when studying receptor pharmacology across species and when developing models for human disease states.

How do CRHR1 genetic polymorphisms influence stress responses and psychopathology?

Research demonstrates that CRHR1 genetic variants modify stress responsivity and susceptibility to mental health disorders . Specific single nucleotide polymorphisms (SNPs) have been associated with altered stress responses:

  • The Rs242924 SNP shows significant association with mental health scores (OR=1.31-1.6, p<0.05) and vitality measures (OR=1.31-1.38, p<0.05) after stressful life events .

  • Rs7209436 and Rs110402 variants are linked to emotional regulation differences and stress resilience .

  • The interaction between Rs242939 and negative life events shows a cross-validation consistency of 10 and p-value of 0.023 after Bonferroni correction, suggesting gene-environment interactions in susceptibility to stress-related disorders .

CRHR1 minor genotypes may confer either vulnerability or resilience to stress-related psychopathology, depending on the specific variant and environmental context . This has implications for understanding individual variability in stress responses in both humans and animal models.

What methodological approaches are optimal for recombinant expression of sheep CRHR1?

For successful recombinant expression of sheep CRHR1, consider these methodological guidelines:

  • Expression System Selection: Mammalian cell lines (typically HEK293 or CHO cells) are preferred over bacterial systems due to the requirement for proper post-translational modifications and membrane insertion .

  • Vector Design: Incorporate epitope tags (e.g., HA, FLAG) at the N-terminal domain to facilitate detection while avoiding interference with the C-terminal cytoplasmic tail, which is critical for G-protein coupling .

  • Transfection Protocol:

    • Transient transfection: Optimal for short-term experiments and binding assays

    • Stable transfection: Essential for long-term functional studies and consistent protein expression

  • Verification Methods:

    • Western blotting for protein expression

    • Immunocytochemistry for membrane localization

    • Radioligand binding assays to confirm functionality

What functional assays are recommended for characterizing recombinant sheep CRHR1?

To comprehensively evaluate the functional properties of recombinant sheep CRHR1, researchers should employ multiple complementary assays:

  • Ligand Binding Assays:

    • Competitive binding assays using labeled CRF or analogs

    • Saturation binding to determine Kd and Bmax values

    • Comparing binding profiles between ovine CRF and human/rat CRF to assess species selectivity

  • G-Protein Coupling Assessment:

    • GTPγS binding studies to measure G-protein activation efficiency

    • Bioluminescence resonance energy transfer (BRET) assays to monitor receptor-G protein interactions in real-time

  • Second Messenger Production:

    • cAMP accumulation assays to quantify adenylate cyclase activation

    • Calcium mobilization assays if coupled to Gαq pathways

  • Receptor Trafficking Studies:

    • Internalization assays using fluorescently tagged receptors

    • Recycling and desensitization measurements to assess receptor dynamics

Research has demonstrated that variants in the cytoplasmic tail of sheep CRHR1 can efficiently interact with Gαs but may fail to effectively stimulate G-protein activation of adenylate cyclase, highlighting the importance of comprehensive functional assessment .

How has CRHR1 evolved across vertebrate species?

Phylogenetic analyses of CRHR1 across vertebrates reveal important evolutionary insights:

  • Gene Duplication Events:

    • crh1 and crh2 paralogs likely resulted from the second round (2R) of vertebrate whole genome duplication

    • Teleost-specific whole genome duplication (3R) produced additional paralogs (crh1a and crh1b) in most teleost fish

  • Conservation and Loss Patterns:

    • crh2 has been identified in holocephalan chondrichthyans, basal mammals, various sauropsids, and non-teleost actinopterygian holosteans

    • Recurrent independent losses of crh genes have occurred in various vertebrate lineages

    • crh1b is conserved in all teleosts studied, while crh1a has been lost independently in some species

  • Phylogenetic Relationships:

    • CRH/UCN1 sequences cluster into three distinct groups (CRH1, CRH2, and UCN1)

    • The sheep CRHR1 shows particular evolutionary conservation with other mammalian species, suggesting functional importance

These evolutionary patterns provide context for understanding the functional conservation and species-specific adaptations of the CRHR1 system.

What methodological approaches are used for evolutionary analysis of CRHR1?

Researchers investigating the evolutionary history of CRHR1 employ several methodological approaches:

  • Sequence Analysis:

    • Multiple sequence alignments using slow algorithms and manual editing based on conserved amino acid sequences

    • Analysis of prepropeptide amino acid sequences rather than just mature peptides, which are highly conserved and provide limited phylogenetic information

  • Phylogenetic Tree Construction:

    • Maximum likelihood analysis using PhyML 3.0

    • WAG substitution matrix selection for CRH family tree inference

    • Branch node strength evaluation using both aLRT and bootstrap with 100 replicates

  • Synteny Analysis:

    • Examination of conserved gene neighborhoods to identify orthologous relationships

    • Identification of chromosomal rearrangements and gene loss events

  • Genome Mining:

    • Comprehensive searches across diverse vertebrate genomes (including 7 chondrichthyans, 14 sarcopterygians, and 48 actinopterygians)

    • Retrieval of 252 sequences from representative vertebrate genome assemblies

These approaches allow researchers to reconstruct the complex evolutionary history of the CRHR1 gene family and understand the functional implications of evolutionary changes.

How should researchers design studies investigating CRHR1 genetic variants?

When investigating CRHR1 genetic variants, careful study design is essential:

  • SNP Selection Strategy:

    • Focus on functional SNPs with demonstrated biological effects (Rs242939, Rs1876828, Rs242941)

    • Include tag SNPs that capture haplotype information across the CRHR1 gene

    • Consider species-specific variation when designing cross-species studies

  • Statistical Power Considerations:

    • Calculate effect sizes and power for each individual SNP (using tools like G*Power)

    • Sample size determination based on anticipated effect size (e.g., with α-error probability of 0.05)

    • Multiple testing correction approaches (e.g., Bonferroni correction) to control for type I errors

  • Gene-Environment Interaction Analysis:

    • Generalized multifactor dimensionality reduction (GMDR) method for examining G×E interactions

    • Assessment of cross-validation consistency, testing balanced accuracy, and empirical p-values

    • Selection of interaction models based on biological interpretability

  • Quality Control Procedures:

    • Hardy-Weinberg equilibrium testing

    • Linkage disequilibrium analysis using tools like Haploview

    • Exclusion of variants with frequencies lower than 1%

What challenges exist in translating CRHR1 findings across species?

Translating CRHR1 research findings across species presents several challenges:

  • Sequence and Structural Differences:

    • Sheep CRHR1 shares 95% homology with human CRHR1, but critical differences exist in ligand binding domains

    • Ovine CRF shares only 84% identity with human/rat CRF, affecting receptor-ligand interactions

  • Signaling Pathway Variations:

    • Species-specific differences in G-protein coupling efficiency and second messenger generation

    • Potential variations in receptor internalization and trafficking mechanisms

  • Genetic Background Effects:

    • Differential genetic modifiers may influence CRHR1 function across species

    • Background strain effects in rodent models that may not translate to sheep or humans

  • Experimental Model Limitations:

    • Cell lines may not fully recapitulate the native receptor environment

    • Differences in post-translational modifications across expression systems

Researchers should account for these species-specific differences when designing experiments and interpreting results, particularly when attempting to translate findings to human clinical applications.

How does the sheep CRHR1 cytoplasmic tail influence signal transduction?

The cytoplasmic tail of sheep CRHR1 plays a critical role in signal transduction and receptor regulation:

  • G-Protein Coupling Efficiency:

    • Research with variant receptors demonstrates that the cytoplasmic tail modulates receptor function related to signal transduction

    • Some CRHR1 cytoplasmic tail variants can efficiently interact with Gαs but fail to effectively stimulate G-protein activation of adenylate cyclase

  • Receptor Internalization Dynamics:

    • Agonist-induced internalization is reduced in CRHR1 cytoplasmic tail variants compared to wild-type receptors

    • This suggests the tail region contains critical determinants for endocytic trafficking

  • Signaling Pathway Selectivity:

    • The cytoplasmic domain may influence which downstream signaling pathways are activated

    • Alterations in this region can potentially shift signaling bias toward different effector mechanisms

  • Phosphorylation Sites:

    • The tail region contains multiple phosphorylation sites that regulate receptor desensitization and β-arrestin recruitment

    • Species-specific differences in these sites may influence receptor regulation

Understanding these mechanisms is essential for properly interpreting functional assays of recombinant CRHR1 and for designing experiments to investigate signaling pathway specificity.

What are promising future research directions for sheep CRHR1?

Several promising research avenues warrant further investigation:

  • Structural Biology Approaches:

    • Cryo-EM or X-ray crystallography studies of sheep CRHR1 to elucidate species-specific binding pocket characteristics

    • Comparative structural analysis with human CRHR1 to identify critical functional domains

  • Genetic Editing Technologies:

    • CRISPR-Cas9 approaches to generate precise CRHR1 variants modeling human polymorphisms

    • Creation of humanized receptor models in sheep to better translate pharmacological findings

  • Systems Biology Integration:

    • Comprehensive characterization of the CRHR1 interactome in sheep tissues

    • Network analysis of stress-responsive pathways downstream of CRHR1 activation

  • Translational Applications:

    • Development of sheep models for stress-related disorders based on CRHR1 genetic variants

    • Testing of novel CRHR1-targeted therapeutics in physiologically relevant sheep models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.