Recombinant Sheep Cytochrome b561 (CYB561)

What is the basic structure of Sheep Cytochrome b561 (CYB561)?

Sheep Cytochrome b561 (CYB561) is a transmembrane protein characterized by a core domain that forms a four-helix bundle structure spanning the membrane. The protein contains four totally conserved histidine residues that coordinate two heme b groups, which are critical for its electron transfer function. The full-length protein consists of 252 amino acids with a specific sequence beginning with MEGPASPAPAPGALPYYVAFSQLLGLTVVAMTGAWLGMYRGGIAWESALQFNVHPLCMVI and continuing through to KTLTEGDSPSSQ . The protein's transmembrane orientation enables it to facilitate electron transport across biomembranes, serving as an essential component in various cellular processes.

How is Sheep CYB561 classified within the broader cytochrome b561 family?

Sheep CYB561 belongs to Group A (animals/neuroendocrine) within the cytochrome b561 protein family classification system. This classification is based on phylogenetic analysis and the presence of specific conserved sequence motifs. Group A is characterized by two distinctive motifs: motif 1 {FN(X)HP(X)2M(X)2G(X)5G(X)ALLVYR} and motif 2 {YSLHSW(X)G} . This classification is significant for researchers as it provides insights into the evolutionary relationships and potential functional similarities with other members of the cytochrome b561 family across different species.

What unique sequence motifs define Sheep CYB561 compared to other species variants?

The Sheep CYB561 contains distinctive sequence motifs that align with Group A (animals/neuroendocrine) of the cytochrome b561 family. While maintaining the core b561 domain, sheep-specific variations may exist in the non-conserved regions. The protein contains the characteristic motifs 1 and 2 as identified in the cytochrome b561 classification system . When comparing Sheep CYB561 (UniProt ID: Q95204) with variants from other species, researchers should focus on the conservation of these key motifs while noting species-specific variations that might influence protein folding, stability, or interaction partners in experimental systems.

What expression systems are optimal for producing recombinant Sheep CYB561?

For recombinant expression of Sheep CYB561, Escherichia coli has been demonstrated as an effective expression system. The commercially available recombinant full-length Sheep Cytochrome b561 protein is produced in E. coli with an N-terminal His tag, suggesting this system provides adequate yields and proper folding for research applications . When establishing your own expression protocol, consider that as a transmembrane protein with multiple helices, CYB561 may present challenges in expression and folding. Optimization of induction conditions (temperature, IPTG concentration, induction time) is critical. For researchers requiring higher expression levels or post-translational modifications, alternative systems such as yeast or insect cells might be considered, though these would require protocol optimization beyond what has been established for the E. coli system.

What are the optimal storage and reconstitution methods for recombinant Sheep CYB561?

Recombinant Sheep CYB561 should be stored as a lyophilized powder at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios to avoid repeated freeze-thaw cycles. For reconstitution, the protein should be briefly centrifuged prior to opening to bring contents to the bottom of the vial. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage stability, adding glycerol to a final concentration of 5-50% is recommended before aliquoting for storage at -20°C/-80°C. The standard recommended final glycerol concentration is 50% . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it can compromise protein integrity and function.

How can researchers verify the functional integrity of purified recombinant Sheep CYB561?

To verify the functional integrity of purified recombinant Sheep CYB561, researchers should employ multiple complementary approaches:

• Structural integrity assessment: SDS-PAGE analysis can confirm purity (>90% is standard for commercial preparations) and molecular weight (approximately 28-30 kDa including the His-tag) .

• Functional assays: Since CYB561 functions as a ferrireductase, measuring Fe3+ to Fe2+ reduction activity using colorimetric assays (such as ferrozine-based methods) can verify functionality. A functional CYB561 should demonstrate increased Fe2+ concentrations in experimental systems .

• Spectroscopic analysis: As a cytochrome containing heme groups, UV-visible spectroscopy should show characteristic absorption peaks that shift upon reduction/oxidation, confirming proper heme incorporation.

• Electron transfer capability: Ascorbate-dependent reduction assays can confirm the protein's ability to transfer electrons across membranes when properly reconstituted in liposomes or membrane systems.

Decreased activity in any of these assays may indicate compromised functional integrity due to improper folding, heme loss, or denaturation during purification or storage.

What is the primary physiological role of CYB561 in neuroendocrine cellular systems?

CYB561 serves multiple critical functions in neuroendocrine cellular systems. Primarily, it functions in ascorbate recycling and neuropeptide activation pathways. The protein replenishes the ascorbic acid pool, which is then utilized by peptidylglycine alpha-amidating monooxygenase (PAM) to activate neuropeptides that promote transformation towards neuroendocrine phenotypes . This process is particularly significant in the context of neuroendocrine prostate cancer (NEPC), where CYB561 expression is upregulated compared to normal prostate tissue . Additionally, CYB561 supports neuropeptide synthesis and secretion, which contributes to paracrine signaling mechanisms. Experimental evidence shows that knockdown of CYB561 in PC-3 cells decreases the expression of neuroendocrine differentiation markers such as SYP, ENO2, and CHGA, confirming its role in maintaining the neuroendocrine phenotype .

How does CYB561 contribute to cellular iron homeostasis?

CYB561 plays a significant role in cellular iron homeostasis through its ferrireductase function. This enzyme activity helps maintain vesicular redox states by catalyzing the reduction of Fe3+ to Fe2+, thereby increasing the availability of intracellular iron essential for regulating cellular activities related to proliferation and survival . Research has demonstrated that knockdown of CYB561 in prostate cancer cell lines reduces intracellular Fe2+ concentration and alters the expression of iron-regulated genes . Specifically, CYB561 knockdown leads to:

• Decreased intracellular Fe2+ levels

• Upregulation of transferrin receptor (TFRC) expression, likely as a compensatory mechanism to increase iron uptake

• Downregulation of ferritin heavy chain (FTH1), which controls iron storage

• Reduced expression of ferroportin (FPN1), which regulates iron efflux

These findings indicate that CYB561 is instrumental in maintaining the labile iron pool (LIP) in cells, which directly impacts various iron-dependent cellular processes essential for normal physiological function and potentially contributes to disease states when dysregulated .

What is the relationship between CYB561 and cancer progression?

Research has established significant links between CYB561 and cancer progression, particularly in prostate cancer models. CYB561 expression is upregulated in metastatic and neuroendocrine prostate cancer (NEPC) tumors and cell lines compared to normal prostate tissue . This upregulation appears to contribute to cancer progression through multiple mechanisms:

• Support of neuroendocrine phenotype: CYB561 maintains the neuroendocrine differentiation (NED) characteristics in cancer cells by supporting the expression of NED markers like synaptophysin (SYP), neuron-specific enolase (ENO2), and chromogranin A (CHGA) .

• Enhanced paracrine signaling: CYB561 contributes to the secretion of paracrine factors that promote tumor growth. Experimental evidence shows that conditioned media from control cells with normal CYB561 expression better supports the survival and proliferation of various prostate cell lines compared to media from cells with CYB561 knockdown .

• Increased cellular proliferation and migration: Knockdown of CYB561 in PC-3 prostate cancer cells results in decreased cell proliferation, reduced colony formation ability, and slower migration rates in wound healing assays .

• Iron metabolism modulation: By increasing iron availability, CYB561 supports cancer cell proliferation and survival, as iron is essential for DNA synthesis, energy metabolism, and other processes critical for rapidly dividing cells .

These findings suggest that CYB561 plays a dual role in cancer progression by integrating neuropeptide signaling and iron metabolism pathways, thus contributing to more aggressive cancer phenotypes, particularly in the context of castration-resistant prostate cancer .

How can researchers effectively use CYB561 knockdown models to study its function?

Researchers can implement effective CYB561 knockdown models using several methodological approaches:

• shRNA-mediated knockdown: Utilize lentiviral vectors containing shRNA sequences targeting CYB561 (e.g., TRCN0000439880 or TRCN0000064575) cloned into pLKO.1 vectors. Package viral particles in HEK293T cells and transduce target cells, followed by puromycin selection (typically 2 μg/mL) to isolate cells with stable knockdown .

• Verification of knockdown efficiency: Employ RT-qPCR to confirm reduced CYB561 mRNA expression levels compared to scrambled shRNA controls. Western blot analysis can provide protein-level verification when appropriate antibodies are available .

• Functional validation: To confirm functional consequences of knockdown, measure intracellular Fe2+ concentrations using colorimetric assays. Additionally, assess expression of iron-regulated genes such as TFRC, FTH1, and FPN1 via RT-qPCR .

• Phenotypic assays: Evaluate proliferation rates using trypan blue exclusion or direct cell counting assays. Colony formation assays can assess transformative properties, while wound healing assays can measure migration capacity .

These models allow researchers to investigate CYB561's role in various cellular processes, including iron metabolism, neuroendocrine differentiation, and cancer cell behavior. When designing such studies, it's critical to include appropriate controls and validate knockdown at both RNA and protein levels to ensure reliable interpretation of results.

What methods are most effective for studying CYB561's role in iron metabolism?

To effectively study CYB561's role in iron metabolism, researchers should employ a multi-faceted methodological approach:

• Intracellular iron measurement:

  • Quantify Fe2+ levels using colorimetric assays such as the ferrozine method

  • Measure total cellular iron using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS)

  • Visualize labile iron pools using fluorescent iron sensors

• Iron regulatory gene expression analysis:

  • Perform RT-qPCR to assess expression levels of key iron regulatory genes:

    • Transferrin receptor (TFRC) - iron uptake

    • Ferritin heavy chain (FTH1) - iron storage

    • Ferroportin (FPN1) - iron efflux

• Enzyme activity assays:

  • Measure ferrireductase activity by monitoring Fe3+ to Fe2+ conversion rates

  • Assess ascorbate recycling capabilities in conjunction with iron reduction

• Comparative studies:

  • Compare wild-type, overexpression, and knockdown models to determine CYB561's specific contributions to iron homeostasis

  • Examine CYB561's effects under various iron conditions (deficiency, overload, normal)

• Subcellular localization studies:

  • Use immunofluorescence or fractionation methods to determine where CYB561 exerts its effects on iron metabolism within cellular compartments

These methods, when used in combination, provide comprehensive insights into how CYB561 influences iron homeostasis and how these changes impact cellular physiology in normal and pathological states.

How can researchers investigate the relationship between CYB561 and neuroendocrine differentiation?

To investigate the relationship between CYB561 and neuroendocrine differentiation, researchers should implement the following methodological approaches:

• Gene expression profiling:

  • Measure expression levels of neuroendocrine markers (SYP, ENO2, CHGA) via RT-qPCR in models with altered CYB561 expression

  • Compare CYB561 expression between normal and neuroendocrine-differentiated cells using both mRNA and protein quantification

• Induction of neuroendocrine differentiation:

  • Utilize transdifferentiation media protocols to induce neuroendocrine phenotypes in prostate cancer cell lines

  • Compare differentiation efficiency between control and CYB561-knockdown cells by monitoring morphological changes and marker expression

• Paracrine signaling assays:

  • Collect conditioned media from cells with normal or reduced CYB561 expression

  • Assess the growth-promoting effects of these media on recipient cells through proliferation assays

  • Quantify specific neuropeptides in conditioned media using ELISA or mass spectrometry techniques

• Functional studies integrating iron metabolism:

  • Simultaneously monitor neuroendocrine marker expression and iron levels following CYB561 manipulation

  • Investigate whether iron supplementation or chelation affects the neuroendocrine differentiation process in the context of CYB561 expression

• In vivo models:

  • Develop xenograft models using cells with modified CYB561 expression

  • Assess tumor growth, metastasis, and neuroendocrine characteristics in these models

By combining these approaches, researchers can establish causal relationships between CYB561 function and neuroendocrine differentiation, potentially revealing mechanisms relevant to diseases like neuroendocrine prostate cancer where this protein plays a significant role .

How does CYB561's dual role in ascorbate recycling and iron metabolism interconnect at the molecular level?

CYB561's dual functionality in ascorbate recycling and iron metabolism represents a sophisticated molecular interconnection that researchers are still elucidating. At the molecular level, these processes are linked through electron transfer mechanisms:

• Structural basis for dual functionality: The transmembrane four-helix bundle structure of CYB561 contains four totally conserved histidine residues that coordinate two heme b groups . This arrangement enables electron transfer across membranes, supporting both ascorbate recycling and ferrireductase activities.

• Electron transfer pathway: CYB561 transfers electrons from cytosolic ascorbate (vitamin C) to intravesicular monodehydroascorbate, thereby recycling ascorbate. This electron transfer capability also enables the reduction of Fe3+ to Fe2+, demonstrating how one structural feature serves both functions.

• Functional consequences in cellular systems: In neuroendocrine contexts, CYB561 replenishes the ascorbic acid pool, which is then utilized by peptidylglycine alpha-amidating monooxygenase (PAM) to activate neuropeptides . Simultaneously, its ferrireductase activity increases the availability of Fe2+, supporting cellular processes dependent on iron.

• Regulatory interplay: Research suggests that ascorbate levels may influence iron metabolism and vice versa. For example, in prostate cancer cells, knockdown of CYB561 reduces Fe2+ levels and alters expression of iron regulatory genes, while also affecting neuropeptide signaling pathways .

This molecular interconnection between ascorbate recycling and iron metabolism through CYB561 represents an elegant example of how a single protein can integrate multiple cellular pathways, particularly relevant in neuroendocrine systems and cancer progression where both pathways play critical roles.

What are the implications of CYB561 expression patterns across different cancer types?

The expression patterns of CYB561 across cancer types have significant implications for understanding cancer biology and developing potential therapeutic approaches:

• Differential expression in cancer subtypes: CYB561 is notably upregulated in metastatic and neuroendocrine prostate cancer (NEPC) compared to normal prostate tissue and other prostate cancer subtypes . This pattern suggests CYB561 may serve as a potential biomarker for specific aggressive cancer phenotypes, particularly those with neuroendocrine features.

• Association with treatment resistance: Elevated CYB561 expression in castration-resistant prostate cancer models indicates a potential role in treatment resistance mechanisms. This association suggests that CYB561 upregulation may be part of the adaptive response to androgen deprivation therapy (ADT) .

• Dual pathway involvement in cancer progression: CYB561's roles in both neuropeptide activation and iron metabolism suggest that its upregulation could simultaneously enhance paracrine signaling and increase iron availability - two processes that support cancer cell proliferation, survival, and migration .

• Potential as a therapeutic target: The observed effects of CYB561 knockdown on reducing cancer cell proliferation, colony formation, and migration capabilities suggest that targeting this protein could impair tumor growth and progression. The dual pathway involvement makes it a particularly interesting target that could disrupt multiple cancer-supporting mechanisms simultaneously .

• Predictive value for disease progression: Changes in CYB561 expression levels might serve as indicators of disease progression, particularly in the context of transformation from adenocarcinoma to more aggressive neuroendocrine phenotypes in prostate cancer.

These implications collectively highlight CYB561 as an important factor in cancer biology with potential diagnostic, prognostic, and therapeutic relevance across multiple cancer types, warranting further investigation into its mechanistic roles and clinical applications.

What technological advances are needed to better characterize the protein-protein interactions of CYB561?

Advancing our understanding of CYB561's protein-protein interactions requires several technological innovations and methodological improvements:

• Membrane protein structural biology techniques:

  • Enhanced cryo-electron microscopy (cryo-EM) methodologies specifically optimized for transmembrane proteins like CYB561

  • Advanced X-ray crystallography approaches for membrane proteins in their native lipid environments

  • Nuclear magnetic resonance (NMR) methodologies capable of resolving dynamic interactions in membrane environments

• Proximity-based interaction mapping:

  • Refinement of proximity labeling techniques (BioID, APEX) specifically designed for transmembrane proteins to identify transient interaction partners

  • Development of split-reporter systems compatible with the transmembrane orientation of CYB561

  • Cross-linking mass spectrometry approaches optimized for membrane protein complexes

• Advanced proteomics methodologies:

  • More sensitive pull-down assays capable of maintaining membrane protein interactions

  • Quantitative interaction proteomics with improved detergent compatibility

  • Development of membrane mimetics that better preserve native protein-protein interactions

• Real-time imaging approaches:

  • Enhanced super-resolution microscopy techniques to visualize CYB561 interactions in live cells

  • Multi-color single-molecule tracking to monitor dynamic interactions with partner proteins

  • Förster resonance energy transfer (FRET) sensors designed specifically for the transmembrane topology of CYB561

• Computational prediction and modeling:

  • Improved machine learning algorithms for predicting membrane protein interactions

  • Molecular dynamics simulations capable of accurately modeling CYB561's interactions within lipid bilayers

  • Integration of structural and functional data into comprehensive interaction networks

These technological advances would significantly enhance our ability to characterize CYB561's interactions with proteins involved in ascorbate recycling, neuropeptide processing, and iron metabolism pathways. This knowledge would provide deeper insights into how CYB561 coordinates its multiple functions and potentially reveal new therapeutic targets in diseases where these pathways are dysregulated.

Physical and Biochemical Properties of Recombinant Sheep CYB561

Effects of CYB561 Knockdown on Prostate Cancer Cell Models

Conserved Motifs in CYB561 Family Classification