Recombinant Sheep Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipment of the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill requests to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with additional charges. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLPSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function

Recombinant Sheep Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, consisting of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Gene References Into Functions
  1. This research suggests that gonadotropins regulate COX2 expression in the cervix and may play a role in cervical relaxation during estrus in ewes. PMID: 27590094
Database Links

KEGG: oas:808252

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cytochrome c oxidase subunit 2 in sheep mitochondria?

Cytochrome c oxidase subunit 2 (MT-CO2) is a core component of the mitochondrial cytochrome c oxidase complex (Complex IV). It contains a dual core CuA active site that plays a significant role in electron transfer during oxidative phosphorylation. The protein accepts electrons from reduced cytochrome c and transfers them through its copper centers to other subunits of the complex, contributing to the proton gradient used for ATP synthesis . In sheep, as in other mammals, MT-CO2 is encoded by mitochondrial DNA and is essential for proper respiratory chain function.

What are the structural characteristics of sheep MT-CO2?

Sheep MT-CO2 is a transmembrane protein with multiple membrane-spanning regions. The first N-terminal membrane-spanning region is particularly important for protein function and stability . The protein contains copper-binding sites that are critical for its electron transfer function. Based on homology with MT-CO2 from other species, sheep MT-CO2 likely has:

  • Molecular weight of approximately 26 kDa

  • An open reading frame of around 684 base pairs encoding approximately 227 amino acids

  • Isoelectric point (pI) around 6.3-6.4

  • Multiple highly conserved domains across mammalian species

How does sheep MT-CO2 interact with other subunits of the cytochrome c oxidase complex?

MT-CO2 forms critical structural associations with other subunits of the cytochrome c oxidase complex, particularly with subunit I (COX I). This interaction is essential for stabilizing the binding of heme a3 to COX I . Disruption of this interaction can lead to reduced stability of multiple subunits, including both mitochondrial DNA-encoded subunits (COX I, COX III) and nuclear-encoded subunits (Vb, VIa, VIb, and VIc) . These interactions are crucial for maintaining the structural integrity and enzymatic function of the entire complex.

What expression systems are most effective for producing recombinant sheep MT-CO2?

Based on research with similar proteins, bacterial expression systems using E. coli (particularly DE3 strains) are commonly employed for recombinant MT-CO2 production. The gene can be subcloned into expression vectors such as pET-32a and induced using isopropyl β-d-thiogalactopyranoside (IPTG) . For sheep MT-CO2 specifically, the following parameters have proven effective:

Expression ParameterRecommended Condition
Expression VectorpET-32a or similar
Host StrainE. coli Transetta (DE3)
Induction AgentIPTG (0.1-1.0 mM)
Induction Temperature25-30°C
Induction Duration4-16 hours

The addition of a 6-His tag facilitates subsequent purification using affinity chromatography methods .

What purification strategies yield the highest purity and functional activity for sheep MT-CO2?

Purification of recombinant sheep MT-CO2 can be achieved through:

  • Affinity chromatography using Ni²⁺-NTA agarose for His-tagged proteins

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing

For optimal results, purification should be performed under mild conditions to preserve protein activity. After purification, protein concentration can be determined spectrophotometrically, with typical yields of purified recombinant protein around 50 μg/mL . Western blotting using specific antibodies can confirm the identity and integrity of the purified protein.

How can I verify the structural integrity and functionality of purified recombinant sheep MT-CO2?

Several complementary approaches can be used to verify both structural integrity and functional activity:

  • Structural verification:

    • SDS-PAGE and western blotting with specific antibodies

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism spectroscopy for secondary structure analysis

  • Functional verification:

    • UV-spectrophotometry to assess the ability to catalyze oxidation of substrate cytochrome c

    • Oxygen consumption measurements using polarographic techniques

    • Electron transfer activity assays using artificial electron donors/acceptors

A functional recombinant MT-CO2 should demonstrate catalytic activity toward cytochrome c oxidation that can be measured spectrophotometrically .

How do mutations in sheep MT-CO2 affect cytochrome c oxidase assembly and function?

Mutations in MT-CO2 can have profound effects on the assembly and function of the entire cytochrome c oxidase complex. For instance, missense mutations in the first membrane-spanning region can disrupt the structural association with COX I, leading to destabilization of heme a3 binding . This can result in:

  • Reduced steady-state levels of multiple COX subunits (both mitochondrially-encoded and nuclear-encoded)

  • Compromised enzymatic activity of the complex

  • Impaired assembly of the holoenzyme

Research has shown that mutations that change conserved residues in MT-CO2, such as the T7671A mutation (resulting in a methionine to lysine substitution at position 29), can lead to severe reductions in COX activity and associated pathophysiological consequences . Studies using immunoblot analysis can reveal the impact of mutations on the stability of various subunits of the complex.

What are the methodological approaches for studying the electron transfer mechanism of sheep MT-CO2?

Understanding the electron transfer mechanism of MT-CO2 requires sophisticated biophysical techniques:

  • Time-resolved spectroscopy: Monitoring the kinetics of electron transfer between cytochrome c and the CuA center of MT-CO2

  • Site-directed mutagenesis: Systematic modification of key residues involved in electron transfer or copper binding to assess their contribution to function

  • Electron paramagnetic resonance (EPR) spectroscopy: Characterization of the copper centers in the protein and their redox states

  • Protein-protein interaction studies: Assessing the interaction between MT-CO2 and cytochrome c using techniques such as isothermal titration calorimetry or surface plasmon resonance

  • Computational molecular dynamics simulations: Modeling electron transfer pathways and conformational changes during the catalytic cycle

These approaches can be combined to develop a comprehensive understanding of the electron transfer mechanism and the role of specific amino acid residues in the process.

How does sheep MT-CO2 interact with allyl isothiocyanate (AITC) and what implications does this have for research applications?

Research has demonstrated that recombinant MT-CO2 can interact with allyl isothiocyanate (AITC), which influences its catalytic activity. Molecular docking studies have revealed that a sulfur atom in the AITC structure can form a hydrogen bond (approximately 2.9 Å in length) with specific amino acid residues, such as Leu-31 . This interaction may:

  • Modify the electron transfer properties of the enzyme

  • Alter substrate binding kinetics or affinity

  • Induce conformational changes affecting catalytic activity

Understanding these interactions provides insights into potential modulators of cytochrome c oxidase activity and offers opportunities for structural biology studies focusing on protein-ligand interactions. This knowledge can be leveraged for point mutation studies targeting the AITC binding site to further elucidate structure-function relationships .

What are the optimal conditions for studying sheep MT-CO2 activity in vitro?

When designing experiments to study the enzymatic activity of sheep MT-CO2, researchers should consider the following parameters:

ParameterOptimal ConditionNotes
Buffer50 mM potassium phosphate, pH 7.4Maintains physiological pH
Temperature25-37°CTemperature dependence can be studied across this range
SubstrateReduced cytochrome c (10-100 μM)Pre-reduced with sodium dithionite
Detergent0.01-0.05% dodecyl maltosideMaintains solubility of membrane protein
Electron acceptorMolecular oxygenCan be monitored using oxygen electrodes

Activity assays typically measure the oxidation of reduced cytochrome c spectrophotometrically by monitoring absorbance changes at 550 nm. For precise measurements, reactions should be performed under controlled oxygen concentrations and temperature conditions.

How can I design experiments to study the association between sheep MT-CO2 and other subunits of cytochrome c oxidase?

Studying subunit interactions requires specialized approaches:

  • Co-immunoprecipitation studies: Using antibodies specific to MT-CO2 or other subunits to pull down interaction partners

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): For analyzing intact cytochrome c oxidase complexes and subcomplexes

  • Proximity labeling techniques: Such as BioID or APEX2 to identify proteins in close proximity to MT-CO2 in the native environment

  • Crosslinking mass spectrometry: To identify specific interaction interfaces between MT-CO2 and other subunits

  • Fluorescence resonance energy transfer (FRET): For studying dynamic interactions in reconstituted systems

When designing these experiments, it's important to preserve the native membrane environment or use appropriate detergents to maintain the structural integrity of the complex.

What controls should be included when analyzing the effects of MT-CO2 mutations on enzyme activity?

Robust experimental design for mutation studies should include:

  • Wild-type protein controls: Always run in parallel with mutant proteins under identical conditions

  • Enzyme kinetics measurements: Determine KM and Vmax parameters for both wild-type and mutant proteins

  • Protein stability controls: Verify that observed changes in activity are not due to decreased protein stability or expression levels

  • Multiple activity assays: Use complementary methods to assess activity, such as spectrophotometric assays and polarographic measurements

  • Structural integrity verification: Confirm that mutations don't cause gross structural changes using techniques like circular dichroism

  • Control mutations: Include mutations at non-critical sites as negative controls and at known functional sites as positive controls

Based on previous studies of MT-CO2 mutations, researchers should monitor not only the direct effects on MT-CO2 but also secondary effects on other subunits of the complex .

Why might recombinant sheep MT-CO2 show low enzymatic activity despite successful expression and purification?

Several factors can contribute to low enzymatic activity of recombinant MT-CO2:

  • Improper copper incorporation: The CuA center may not be properly formed during recombinant expression. Supplementing growth media with copper salts or performing in vitro metal reconstitution may help.

  • Protein misfolding: As a membrane protein, MT-CO2 may not fold properly in bacterial expression systems. Consider using membrane-mimetic environments during purification and activity assays.

  • Missing interaction partners: MT-CO2 normally functions as part of a multi-subunit complex. The absence of other subunits, particularly COX I, may limit its activity .

  • Oxidative damage during purification: Exposure to oxidizing conditions during purification may damage redox-active centers. Include reducing agents in purification buffers.

  • Suboptimal assay conditions: Activity may be influenced by pH, ionic strength, and detergent concentration. Systematically optimize these parameters.

How can I improve the yield and stability of recombinant sheep MT-CO2?

To enhance yield and stability of recombinant MT-CO2:

  • Optimize codon usage: Adapt the MT-CO2 gene sequence for optimal expression in the host organism

  • Explore fusion partners: Different fusion tags (MBP, GST, SUMO) may improve solubility and stability

  • Use specialized expression hosts: Consider strains with enhanced disulfide bond formation or membrane protein expression capability

  • Optimize induction conditions: Lower temperatures (16-20°C) and longer induction times often improve proper folding

  • Include stabilizing additives: Glycerol (10-20%), reducing agents, and specific lipids can enhance stability

  • Consider refolding approaches: If inclusion bodies form, develop a refolding protocol using mild detergents or lipid nanodiscs

What are common analytical pitfalls when studying sheep MT-CO2 and how can they be addressed?

Researchers should be aware of these potential pitfalls:

  • Heterogeneity in copper content: Variable metal incorporation can lead to inconsistent activity measurements. Quantify metal content using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry.

  • Detergent interference: Some detergents can affect activity assays or interact with substrates. Test multiple detergent types and concentrations.

  • Oxygen sensitivity: The reduced form of MT-CO2 can be sensitive to oxygen. Perform sensitive experiments under controlled atmosphere conditions.

  • Aggregation during storage: Membrane proteins are prone to aggregation. Monitor protein state using dynamic light scattering and optimize storage conditions.

  • Cross-reactivity in immunoassays: Antibodies may cross-react with related proteins. Validate antibody specificity using appropriate controls and western blotting .

How can recombinant sheep MT-CO2 be used to study mitochondrial dysfunction in disease models?

Recombinant sheep MT-CO2 can serve as a valuable tool for understanding mitochondrial dysfunction:

  • Comparative studies with disease-associated mutations: Introducing disease-associated mutations into recombinant MT-CO2 can help understand their biochemical consequences .

  • Development of functional assays: Purified MT-CO2 can be used to develop sensitive assays for detecting changes in cytochrome c oxidase activity.

  • Screening for therapeutic compounds: The recombinant protein can serve as a target for screening compounds that might restore function to mutated variants.

  • Structure-function relationship studies: Systematic mutagenesis can identify critical residues and domains that are potential hotspots for disease-causing mutations.

  • Antibody generation: The recombinant protein can be used to generate specific antibodies for immunodetection of MT-CO2 in tissue samples from disease models .

What approaches can be used to study the interaction between sheep MT-CO2 and environmental toxins or pharmaceutical compounds?

To investigate interactions with exogenous compounds:

  • Enzyme inhibition assays: Measure MT-CO2 activity in the presence of varying concentrations of compounds to determine IC50 values.

  • Thermal shift assays: Assess the effect of compounds on protein thermal stability, which can indicate binding.

  • Molecular docking and in silico screening: Computational approaches can predict binding sites and affinities, as demonstrated with AITC .

  • Direct binding measurements: Techniques like isothermal titration calorimetry or microscale thermophoresis can quantify binding parameters.

  • Structure-activity relationship studies: Systematic testing of related compounds can identify key chemical features necessary for interaction.

These approaches can help identify compounds that might affect mitochondrial function through interaction with MT-CO2, with potential implications for toxicology and drug development.

How can sheep MT-CO2 research contribute to understanding species-specific differences in mitochondrial function?

Comparative studies of MT-CO2 across species can provide insights into:

  • Evolutionary adaptations in energy metabolism: Differences in MT-CO2 structure and function may reflect adaptations to different environmental niches or metabolic demands.

  • Species-specific disease susceptibility: Variations in MT-CO2 might contribute to differences in susceptibility to mitochondrial disorders across species.

  • Metabolic rate determination: As part of the electron transport chain, MT-CO2 may contribute to species-specific differences in basal metabolic rate.

  • Environmental adaptation mechanisms: Comparing MT-CO2 from sheep adapted to different environments may reveal functional adaptations.

Research comparing sheep MT-CO2 with that of other species can contribute to broader understanding of evolutionary biochemistry and comparative physiology of mitochondrial function .

What emerging technologies are likely to advance our understanding of sheep MT-CO2 structure and function?

Several cutting-edge technologies show promise for MT-CO2 research:

  • Cryo-electron microscopy: Enabling high-resolution structural analysis of membrane protein complexes without crystallization

  • Single-molecule techniques: Including single-molecule FRET and force spectroscopy to study conformational dynamics

  • In-cell NMR spectroscopy: Providing insights into protein behavior in a native-like environment

  • Advanced mass spectrometry approaches: Including hydrogen-deuterium exchange mass spectrometry for studying protein dynamics and interactions

  • CRISPR-based genome editing: For creating precise mutations in the mitochondrial genome to study MT-CO2 variants in cellular models

These technologies can provide unprecedented insights into the structure, dynamics, and interactions of MT-CO2 in its native context.

How might studies of sheep MT-CO2 contribute to the development of mitochondrial therapeutics?

Research on sheep MT-CO2 has potential applications in therapeutic development:

  • Identification of allosteric sites: Detailed structural studies may reveal sites that could be targeted to modulate enzyme activity

  • Development of enzyme replacement approaches: Understanding sheep MT-CO2 structure and function could inform the design of synthetic cytochrome c oxidase complexes for therapeutic use

  • Screening platforms for drug discovery: Recombinant MT-CO2 can serve as a target in high-throughput screens for compounds that enhance enzyme activity or stability

  • Biomarker development: Knowledge of MT-CO2 structure and function could lead to the identification of biomarkers for mitochondrial disorders

  • Species-specific drug responses: Comparative studies between sheep and human MT-CO2 could help predict species-specific responses to pharmaceuticals that target mitochondrial function

What are the potential applications of sheep MT-CO2 in biotechnology and bioenergy research?

Sheep MT-CO2 research has several potential biotechnological applications:

  • Biofuel cell development: Understanding electron transfer mechanisms in MT-CO2 could inform the design of bioelectrochemical systems

  • Biosensors for environmental toxins: Given its interaction with compounds like AITC , MT-CO2 could be developed into biosensors for detecting specific environmental toxins

  • Greenhouse gas mitigation strategies: Understanding MT-CO2 in the context of sheep metabolism could contribute to strategies for reducing methane emissions from livestock

  • Biomimetic catalysts: Insights from MT-CO2 structure and function could inspire the development of synthetic catalysts for oxygen reduction reactions

  • Protein engineering for enhanced stability: Knowledge gained from studying sheep MT-CO2 could be applied to engineer more stable variants of cytochrome c oxidase for industrial applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.