Recombinant Sheep Gap junction alpha-8 protein (GJA8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate any preferred format in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal quality, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
While the tag type is finalized during production, we are open to your specific requirements. If you have a preferred tag type, please inform us, and we will prioritize its implementation whenever possible.
Synonyms
GJA8; Gap junction alpha-8 protein; Connexin-49; Cx49; Lens fiber protein MP70; MP38; MP64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-440
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
GJA8
Target Protein Sequence
GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLVYVGHAVHHVRMEEKRKEREAEELSQQSPGN GGERAPLAADQGSVKKSSSSSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYG FRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNILEMSHLGLKKIRS AFKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVEASPLSA KPFSQFEEKVGPGPLGDLSRAYQETLPSYAQVGAQEGVEEEQPIEAAAEPEVGDKSQEAE RVSTEGEETLAVLEEEKVEPPEVEKEAEKEETPPEKVSKQELTPEKAPSLCAELPGEDTR PLSRLSKASSRARSDDLTV
Uniprot No.

Target Background

Function
Gap junction alpha-8 protein (GJA8) is a structural component of eye lens gap junctions. Gap junctions are essential for cellular communication, forming dodecameric channels that connect the cytoplasm of adjacent cells. This connection is facilitated by the docking of two hexameric hemichannels, one originating from each cell membrane. Through the central pore of these channels, small molecules and ions can diffuse from one cell to its neighboring cell, playing a crucial role in intercellular communication.
Database Links

KEGG: oas:100170231

UniGene: Oar.17419

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Detected in eye lens (at protein level). Eye lens.

Q&A

What is the proper storage protocol for recombinant sheep GJA8 protein?

Recombinant sheep GJA8 protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios. It's recommended to avoid repeated freeze-thaw cycles as this can compromise protein integrity. For working aliquots, storage at 4°C for up to one week is acceptable .

For reconstitution, the lyophilized protein should be briefly centrifuged prior to opening, then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting enables long-term storage at -20°C/-80°C .

What expression systems are typically used for recombinant sheep GJA8 production?

Escherichia coli (E. coli) is the predominant expression system for recombinant sheep GJA8 protein production. This bacterial expression system allows for the efficient production of the full-length mature protein (amino acids 2-440) with an N-terminal His tag . The bacterial expression system offers advantages in terms of yield and cost-effectiveness for basic research applications.

When comparing expression systems, researchers should consider that eukaryotic expression systems might provide different post-translational modifications compared to prokaryotic systems, which could affect functional studies depending on research objectives.

What are the available protein tags for recombinant sheep GJA8 and their impact on protein function?

Commercially available recombinant sheep GJA8 typically includes an N-terminal His tag to facilitate purification . This affinity tag allows for simple one-step purification using metal affinity chromatography.

When designing experiments, researchers should consider potential tag interference with protein function. While the His tag is relatively small and generally minimally disruptive, it may affect protein-protein interactions or certain functional assays. For critical functional studies, researchers might consider tag removal using proteases or comparing results with untagged versions of the protein.

How can the purity and integrity of recombinant sheep GJA8 be assessed?

The purity of recombinant sheep GJA8 is typically assessed using SDS-PAGE analysis, with commercial preparations generally exceeding 90% purity . For comprehensive characterization, researchers should consider:

  • Western blotting with GJA8/Connexin-49 specific antibodies to confirm identity

  • Size exclusion chromatography to assess aggregation state

  • Mass spectrometry to confirm the exact molecular weight and potential post-translational modifications

  • Circular dichroism to evaluate secondary structure integrity

For functional validation, immunofluorescence can be employed to verify proper membrane localization in transfected cells, as demonstrated with the human variant, which exhibits substantial labeling at appositional membranes .

What are the optimal transfection methods for GJA8 expression in mammalian cells?

For mammalian cell expression, transient transfection of GJA8 has been successfully performed in HeLa cells . When designing transfection protocols, consider:

  • Cell line selection: HeLa cells have been validated for GJA8 expression and functional studies

  • Plasmid design: Include appropriate mammalian promoters and codon optimization if necessary

  • Transfection method: Lipid-based transfection reagents have proven effective

  • Expression verification: Immunoblotting can confirm expression levels and protein size

  • Functional validation: Immunofluorescence to visualize gap junction plaque formation

Successful transfection should result in detectable protein expression by Western blotting and membrane localization visible by immunofluorescence, particularly at appositional membranes between adjacent cells .

What functional assays are available to assess GJA8 gap junction activity?

Several functional assays can evaluate GJA8 gap junction activity:

  • Neurobiotin transfer assay: This technique directly assesses intercellular communication by microinjecting the gap junction-permeable tracer Neurobiotin into cells and monitoring its transfer to neighboring cells. Both wild-type and variant GJA8 proteins can be evaluated for their ability to form functional channels using this approach .

  • Dye coupling assays: Using fluorescent dyes like Lucifer Yellow to assess gap junction permeability.

  • Electrophysiological measurements: Dual patch-clamp recordings to measure gap junctional conductance.

  • Calcium wave propagation: Monitoring the spread of calcium signals between coupled cells.

For rigorous assessment, the Neurobiotin transfer assay has proven particularly valuable, with studies showing that wild-type Cx50 (GJA8) successfully transfers Neurobiotin to neighboring cells with a coupling incidence of 9/9, comparable to the N220D variant with 10/11 .

How can CRISPR/Cas9 be optimized for GJA8 knockout models?

CRISPR/Cas9-mediated knockout of GJA8 has been successfully implemented in rabbit models to study its role in cataract formation. Key optimization parameters include:

  • sgRNA design: Dual sgRNAs targeting the CDS of GJA8 have achieved efficient gene disruption, with mutation rates as high as 98.7% in injected blastocysts .

  • Delivery method: Microinjection of in vitro transcribed Cas9 mRNA (180 ng/μl) and sgRNAs (40 ng/μl) into zygotes at the pronuclear stage has proven effective .

  • Efficiency assessment: T7E1 assay and PCR Sanger sequencing can confirm successful gene editing.

  • Off-target analysis: Careful selection of sgRNAs and comprehensive off-target site analysis is essential, with previous studies showing negligible off-target effects when using optimized sgRNA designs .

The table below summarizes the outcomes of GJA8 knockout in rabbits:

RecipientsgRNA/Cas9 mRNA (ng/μl)Embryos transferredPregnancyPups obtained (% transferred)Pups with mutations (%)Bi-allelic modified (%)Pups with Cataract (%)
140/18052YES5 (9.6%)5 (100%)0 (0%)4 (80.0%)
240/18058YES6 (10.3%)6 (100%)0 (0%)4 (66.7%)

How can researchers differentiate between pathogenic and benign variants of GJA8?

Differentiation between pathogenic and benign GJA8 variants requires a multifaceted approach:

The c.658A>G/N220D variant demonstrates the complexity of interpretation: despite bioinformatic predictions of pathogenicity and presence in affected individuals, functional studies showed normal membrane localization and gap junction activity, suggesting it may be a benign rare variant .

What are the current methodologies for studying GJA8 involvement in lens development and cataract formation?

Advanced methodologies for studying GJA8's role in lens development and cataract formation include:

  • Animal models: CRISPR/Cas9-mediated knockout in rabbits has successfully recapitulated human congenital cataracts, with 8 of 11 F0 GJA8 mutated rabbits developing cataracts with lens opacities .

  • Histological analysis: H&E staining reveals that GJA8 mutant lenses have severely distorted inner fiber cells compared to the well-aligned inner fiber cells of wild-type rabbits .

  • Protein expression analysis: Western blotting shows reduced protein levels in the lenses of adult GJA8 (+/-) rabbits compared to wild-type counterparts .

  • Ultrastructural investigation: Thin-section immunolabeling and electron microscopy can assess gap junction formation. GJA8 mutant rabbits show weaker fluorescent signals in the outermost fiber cells and smaller gap junctions in cortical fibers compared to wild-type rabbits .

  • Molecular genetic analysis: Exome sequencing has identified GJA8 variants in families with congenital cataracts, though penetrance may be incomplete .

These methodologies collectively provide comprehensive insights into GJA8 function in lens development and the mechanisms underlying cataract formation.

How can interspecies differences in GJA8 be leveraged for understanding protein function?

Understanding interspecies differences in GJA8 can provide valuable insights into protein function:

  • Comparative sequence analysis: Despite variations between species, key functional regions show high conservation. For example, the asparagine residue at position 220 is highly conserved across species and isoforms, suggesting functional importance .

  • Cross-species functional complementation: Expressing GJA8 from different species in knockout models can reveal conserved and species-specific functions.

  • Evolutionary analysis: Tracing the evolutionary changes in GJA8 across species can identify regions under selective pressure, indicating functional importance.

  • Species-specific phenotypic variations: Comparing phenotypes of GJA8 mutations across species models. For instance, rabbit models with GJA8 mutations develop cataracts with lens opacities and show severely distorted inner fiber cells , which can be compared with human and mouse phenotypes.

  • Structure-function relationship: Using crystallographic data from various species to correlate structural differences with functional variations.

By systematically analyzing these interspecies differences, researchers can identify conserved functional domains crucial for gap junction formation and activity, as well as species-specific adaptations that may influence lens development and transparency.

What are common challenges in working with recombinant GJA8 and how can they be addressed?

Researchers working with recombinant GJA8 may encounter several challenges:

  • Protein solubility issues: As a membrane protein, GJA8 can aggregate during purification and storage.

    • Solution: Optimize buffer conditions with appropriate detergents or lipid environments. Including 6% trehalose in Tris/PBS-based buffer at pH 8.0 has been effective for maintaining stability .

  • Functional confirmation: Verifying that recombinant GJA8 maintains its native functionality.

    • Solution: Implement functional assays such as Neurobiotin transfer in transfected cells to confirm gap junction activity .

  • Variable expression levels: Inconsistent protein yields from expression systems.

    • Solution: Optimize codon usage for the expression host and consider using inducible promoter systems to control expression timing and levels.

  • Protein degradation: Membrane proteins are often susceptible to proteolytic degradation.

    • Solution: Add protease inhibitors during purification and storage. Avoid repeated freeze-thaw cycles by storing aliquots at -20°C/-80°C .

  • Tag interference: Affinity tags may affect protein function or structure.

    • Solution: Compare tagged and untagged versions when possible, or consider using cleavable tags that can be removed after purification.

How can researchers accurately assess the physiological relevance of GJA8 mutations identified in genetic studies?

Establishing physiological relevance of GJA8 mutations requires multiple lines of evidence:

The c.658A>G (p.N220D) variant exemplifies the complexity of this assessment: despite being predicted as pathogenic by bioinformatic tools and being present in affected individuals, functional studies showed normal membrane localization and gap junction activity, suggesting it may be a benign rare variant .

What emerging technologies might advance our understanding of GJA8 function in lens development?

Several emerging technologies hold promise for deepening our understanding of GJA8 function:

  • Single-cell transcriptomics: Profiling gene expression at the single-cell level throughout lens development can reveal the temporal dynamics of GJA8 expression and its co-expression patterns with other genes.

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize gap junction plaque formation with unprecedented detail

    • Live-cell imaging to monitor gap junction dynamics in real-time

    • Correlative light and electron microscopy (CLEM) to link functional observations with ultrastructural details

  • Organoid models: Developing lens organoids from stem cells can provide in vitro systems to study GJA8 function in human lens development without the limitations of animal models.

  • Base editing and prime editing: These CRISPR derivatives enable precise introduction of specific mutations without double-strand breaks, allowing more subtle manipulation of GJA8 to create precise disease models .

  • Cryo-electron microscopy: Determining high-resolution structures of GJA8 gap junction channels to understand how mutations affect channel structure and function.

  • Optogenetic tools: Developing light-controllable versions of GJA8 could allow temporal control of gap junction function to study its role during specific developmental windows.

How can systems biology approaches enhance our understanding of GJA8 in lens homeostasis?

Systems biology approaches can provide comprehensive insights into GJA8's role in lens homeostasis:

  • Interactome mapping: Identifying the complete set of proteins that interact with GJA8 can reveal its broader functional network. Techniques such as proximity labeling (BioID, APEX) coupled with mass spectrometry can identify both stable and transient interactions.

  • Multi-omics integration: Combining transcriptomic, proteomic, and metabolomic data from normal and GJA8-mutant lenses can highlight pathways affected by GJA8 dysfunction.

  • Network analysis: Constructing gene regulatory networks and protein-protein interaction networks can position GJA8 within the broader context of lens development and homeostasis.

  • Mathematical modeling: Developing computational models of ion and metabolite diffusion through gap junctions can predict how GJA8 mutations might affect lens physiology.

  • Comparative systems approach: Analyzing how the lens gap junction network varies across species can reveal evolutionary adaptations and conserved mechanisms.

  • Temporal dynamics: Studying how the GJA8 interactome changes during lens development and aging can reveal stage-specific functions and potential intervention points for treating GJA8-related disorders.

This systems-level understanding could reveal new therapeutic targets for preventing or treating cataracts and other lens disorders associated with GJA8 dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.