Recombinant Sheep Gap junction beta-2 protein (GJB2)

Shipped with Ice Packs
In Stock

Description

Research Applications and Mutational Analysis

Recombinant GJB2 is pivotal in elucidating pathogenic mutations linked to hearing loss and skin disorders. For example:

Common Pathogenic Mutations in GJB2

MutationEffect on ProteinClinical PhenotypeFrequency in Studies
W24X (c.71G>A)Premature stop codon; truncated proteinProfound congenital hearing loss25% (India)
W77X (c.231G>A)Truncation at transmembrane domainSevere hearing loss5% (India)
R127H (c.380G>A)Missense; disrupted channel gatingSevere hearing loss15% (India)
c.35delGFrameshift; nonfunctional proteinAutosomal recessive deafness5.5% (Turkey)

Functional Insights from Recombinant Models

  • Loss-of-function mutations (e.g., W24X, W77X) disrupt potassium recycling in the cochlea, leading to sensorineural hearing loss .

  • Missense mutations (e.g., R127H) impair channel permeability or trafficking, as shown in Xenopus oocyte assays .

  • 3D structural modeling reveals that truncations (e.g., W24X) eliminate critical transmembrane domains, abolishing channel assembly .

Therapeutic and Diagnostic Implications

Recombinant GJB2 aids in:

  • Genetic screening: Identifying carriers of biallelic mutations (e.g., 35delG, W24X) in populations with high consanguinity rates .

  • Drug response studies: High GJB2 expression correlates with cisplatin/paclitaxel resistance in cervical cancer .

  • Gene therapy development: Functional rescue of mutant Cx26 via viral vectors is under preclinical investigation .

Challenges and Future Directions

  • Variant interpretation: Benign polymorphisms (e.g., V27I, E114G) complicate clinical diagnostics .

  • Immune interactions: High GJB2 expression alters tumor immune microenvironments, necessitating further study .

  • Species-specific models: Developing sheep-specific recombinant GJB2 could advance auditory research in agriculturally relevant species.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate any preferences when placing your order, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipment, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJB2; Gap junction beta-2 protein; Connexin-26; Cx26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MDWSALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYYRHEKKRKFIRGEIKTEFKDIEE IKNQKVRIEGSLWWTYTGSIFFRVIFEAAFMYVFYVMYDGFAMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRFCSGKSKKPV
Uniprot No.

Target Background

Function
Gap junction beta-2 protein (GJB2) is a structural component of gap junctions. These junctions are dodecameric channels that connect the cytoplasm of adjacent cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to its neighbor through the central pore.
Database Links

KEGG: oas:443345

UniGene: Oar.400

Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Gap Junction Beta-2 protein and what is its primary function?

Gap Junction Beta-2 protein (GJB2), also known as Connexin-26 (Cx26), is a structural component of gap junctions that functions as a critical intercellular communication protein. It belongs to the connexin family, specifically the Beta-type (group I) subfamily. Gap junctions are specialized channel structures that directly connect the cytoplasm of adjacent cells. These dodecameric channels are formed by the docking of two hexameric hemichannels (connexons), with one connexon contributed by each adjoining cell membrane. The primary function of GJB2 is to facilitate the diffusion of small molecules and ions between neighboring cells through this central pore, allowing for essential intercellular communication and metabolic coupling .

How does sheep GJB2 compare structurally to human GJB2?

While the search results don't specifically detail sheep GJB2, research on connexin proteins shows high conservation across mammalian species. Human GJB2 is a 226 amino acid protein with a distinctive structure that includes four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-terminal regions. The amino acid sequence of human GJB2 begins with "MDWGTLQTILGGVNK" and continues through a characteristic pattern of hydrophobic and hydrophilic residues that enable proper folding and membrane insertion . Though sheep GJB2 would be expected to share significant homology with human GJB2, researchers should note potential species-specific variations that might affect antibody recognition, protein-protein interactions, and functional properties when designing experiments.

What expression systems are commonly used for producing recombinant GJB2 protein?

Several expression systems have been successfully employed for producing recombinant GJB2 protein. For human GJB2, wheat germ expression systems have demonstrated efficacy in generating full-length protein suitable for applications including SDS-PAGE, ELISA, and Western blotting . For functional studies of rat GJB2, insect cell lines infected with baculovirus vectors containing GJB2 cDNA have proven valuable for producing protein that maintains channel functionality . When working specifically with recombinant sheep GJB2, researchers should consider that the optimal expression system may depend on several factors including the desired post-translational modifications, required protein yield, and intended downstream applications.

What are the recommended methods for assessing GJB2 channel functionality in vitro?

For assessing GJB2 channel functionality in vitro, several well-established methodologies can be employed:

  • Planar Lipid Bilayer Reconstitution: This approach allows for direct measurement of channel conductance properties. Isolated GJB2 connexons can be reconstituted into planar lipid bilayers for single-channel recording. Studies using this method have demonstrated that GJB2 channels exhibit a range of conductance values, with primary conductance of 35-45 pS in 200 mM KCl, while channels with conductance values of 60 pS and 90-110 pS may also be observed within the same connexon population . This heterogeneity suggests functional versatility that may be relevant to physiological contexts.

  • Scrape Loading and Dye Transfer Assay: This technique quantifies gap junction intercellular communication (GJIC). Monolayers of confluent cells are wounded in the presence of a tracer (such as Neurobiotin) that can pass through gap junctions. After a brief incubation period, cells are fixed, permeabilized, and visualized using fluorescent streptavidin conjugates. The extent of dye spread from wounded cells to neighboring cells provides a quantitative measure of GJIC functionality .

  • Immunofluorescence Analysis: Gap junction plaque formation can be visualized through immunostaining with specific anti-GJB2 antibodies, followed by confocal microscopy. Quantitative parameters such as plaque length, area, form factor, and length-to-area factor (LAF) can be measured to assess the integrity and extent of gap junction formation .

How can researchers effectively validate the purity and identity of recombinant sheep GJB2 protein?

To validate the purity and identity of recombinant sheep GJB2 protein, researchers should implement a multi-faceted approach:

  • SDS-PAGE and Western Blotting: Separation of the recombinant protein by SDS-PAGE reveals its molecular weight and purity. Human GJB2 has a molecular weight of approximately 26 kDa. Western blotting using specific anti-GJB2 antibodies confirms protein identity . When working with sheep GJB2, researchers should verify antibody cross-reactivity with the sheep protein.

  • Mass Spectrometry: Peptide mass fingerprinting and tandem mass spectrometry (MS/MS) provide definitive identification through sequence analysis. This approach can also identify post-translational modifications that may affect protein function.

  • N-terminal Sequencing: Direct protein sequencing of the first 10-15 amino acids offers unambiguous confirmation of the protein's identity and verifies the correct processing of any signal sequences or purification tags.

  • Functional Assays: Channel conductance measurements in reconstituted systems, as described in section 2.1, provide validation of the protein's native folding and functional capability .

What are the critical parameters for optimizing transfection of GJB2 expression constructs?

When optimizing transfection of GJB2 expression constructs, researchers should consider several critical parameters:

  • Cell Type Selection: The choice of recipient cells significantly impacts transfection efficiency and subsequent protein expression. Research has successfully used HeLa cells for expressing GJB2 variants, including the R75W mutant .

  • Transfection Reagent and Protocol: Reagents like FuGENE HD have demonstrated efficacy for GJB2 construct delivery. The optimized protocol involves seeding cells at approximately 1 × 10^5 cells per well in 12-well plates 48 hours before transfection .

  • DNA Quality and Concentration: Highly purified plasmid DNA at optimal concentrations is essential for efficient transfection. The concentration should be determined based on the specific transfection reagent's recommendations.

  • Post-Transfection Analysis Timeline: For GJB2 expression analysis, EGFP+ cells can be sorted 48 hours post-transfection to assess immediate expression. For functional analyses of gap junction formation, cells should be cultured for an additional period (typically 4-7 days) to allow for protein expression, trafficking, and junction assembly .

  • Selection Strategy: For stable expression, appropriate selection markers and concentration optimization are crucial to eliminate non-transfected cells while maintaining the viability of successfully transfected populations.

How do common GJB2 mutations affect gap junction functionality at the molecular level?

Common GJB2 mutations significantly alter gap junction functionality through various molecular mechanisms. The R75W mutation, which has been extensively studied, provides important insights into these effects:

  • Impaired Channel Formation: Mutations like R75W disrupt the ability of GJB2 to form functional gap junction plaques between adjacent cells. This impairment can be visualized through immunofluorescence microscopy, which reveals altered gap junction morphology and distribution at cell-cell interfaces .

  • Altered Conductance Properties: Mutations may modify the channel's biophysical properties, including conductance and voltage sensitivity. Wild-type GJB2 channels typically exhibit conductance values of 35-45 pS in 200 mM KCl, but mutations can significantly alter these parameters or completely abolish channel activity .

  • Compromised Molecular Permeability: GJB2 mutations can selectively impair the passage of specific molecules through gap junction channels, disrupting intercellular communication. This can be quantified using dye transfer assays, which demonstrate reduced transfer of tracer molecules between cells expressing mutant GJB2 .

  • Cellular Homeostasis Disruption: Defects in GJB2 functionality lead to reduced intracellular ATP levels and impaired calcium signaling, which are essential for normal cellular function and development. In cochlear cells with decreased Cx26 expression, significantly reduced ATP levels and hampered Ca^2+ responses to extracellular ATP application have been observed .

What approaches are being developed to correct pathogenic GJB2 mutations in research models?

Innovative approaches for correcting pathogenic GJB2 mutations in research models include:

  • AAV-Mediated Base Editing: Adeno-associated virus (AAV) vectors carrying base editing machinery represent a promising approach for correcting point mutations in the GJB2 gene. Recent research has focused on developing optimized base editors and delivery systems to restore functional GJB2 expression in cochlear cells .

  • CRISPR-Cas9 Gene Editing: Various CRISPR-Cas9 strategies are being explored to precisely correct GJB2 mutations. These include:

    • SaABE (Staphylococcus aureus adenine base editor) systems with different guide RNAs

    • CjABE (Campylobacter jejuni adenine base editor) systems

    • Modified TadA8e mutants that improve editing efficiency while minimizing off-target effects

  • Efficiency Optimization: Researchers have developed multiple editing constructs (such as SaABE#1-5 and CjABE#6) with varying guide RNAs to identify optimal combinations for specific mutations. Editing efficiency can be assessed through amplicon sequencing and functional recovery of gap junction plaque formation .

  • Functional Restoration Assessment: After base editing, restoration of gap junction functionality can be evaluated through multiple parameters including gap junction plaque length, area, form factor, and length-to-area factor, compared to wild-type controls .

Why is GJB2 particularly important in cochlear function and hearing research?

GJB2 plays a crucial role in cochlear function and hearing for several fundamental reasons:

  • Genetic Significance: Mutations in the GJB2 gene are the predominant cause of prelingual hereditary deafness, making it the most clinically relevant gene in non-syndromic hearing loss. The most frequently encountered variants cause complete loss of protein function .

  • Developmental Role: GJB2 is essential for proper cochlear development. Mouse models with reduced Cx26 expression exhibit severe hearing impairment after weaning, demonstrating its critical role in hearing acquisition .

  • Cellular Homeostasis Regulation: In the cochlea, GJB2-formed gap junctions maintain ionic homeostasis and allow for the recycling of potassium ions crucial for the transduction of auditory signals. This intercellular communication network is essential for normal hearing function.

  • Cell Survival Regulation: Reduced GJB2 expression disrupts the balance between apoptosis and autophagy during cochlear development. TUNEL-positive cells have been observed in Kölliker's organ at postnatal day 1 (P1) in mice with Cx26 deficiency, associated with increased expression of cleaved caspase 3 and decreased levels of autophagy-related proteins LC3-II, P62, and Beclin1 .

  • ATP and Calcium Signaling: GJB2 deficiency leads to reduced intracellular ATP levels and impaired calcium signaling responses, both of which are essential for proper cochlear development and function .

What are the methodological considerations when using GJB2-deficient animal models for hearing research?

When using GJB2-deficient animal models for hearing research, several methodological considerations are essential:

  • Model Selection and Genetic Background: Various models are available, including conditional knockout systems like the Gjb2 loxP/loxP; ROSA26 CreER mice that allow for temporal control of Cx26 deletion through tamoxifen injection. The genetic background of these models can influence phenotype severity and should be reported in publications .

  • Temporal Induction Protocols: For conditional knockout models, the timing of Cx26 deletion critically affects phenotype development. Tamoxifen injection on the day of birth produces severe hearing impairment after weaning, but different timing may result in varying phenotypes .

  • Comprehensive Functional Assessment: Hearing function should be evaluated using multiple complementary techniques:

    • Auditory brainstem response (ABR) measurements

    • Distortion product otoacoustic emissions (DPOAEs)

    • Endocochlear potential (EP) recordings

    • Cochlear microphonics (CM)

  • Cellular and Molecular Analyses: Key molecular parameters to assess include:

    • Apoptosis markers (TUNEL staining, cleaved caspase 3)

    • Autophagy markers (LC3-II, P62, Beclin1)

    • ATP levels in cochlear cells

    • Calcium signaling responses to extracellular ATP application

  • Sex-Balanced Experimental Design: Experiments should include animals of both sexes to account for potential sex-specific differences in GJB2-related phenotypes .

How can recombinant GJB2 be used to investigate protein-protein interactions within gap junction complexes?

Recombinant GJB2 provides valuable opportunities for investigating protein-protein interactions within gap junction complexes through several sophisticated approaches:

  • Co-Immunoprecipitation Studies: Purified recombinant GJB2 tagged with epitopes such as FLAG or 6xHis can be used in pull-down assays to identify interacting proteins. This approach has revealed interactions between GJB2 and other connexins as well as cytoskeletal and scaffolding proteins.

  • Proximity Labeling Methods: Techniques such as BioID or APEX2 proximity labeling, where recombinant GJB2 is fused to a biotin ligase or peroxidase, enable the identification of proteins in close proximity to GJB2 in living cells. This approach provides a more physiological context for interaction studies.

  • Fluorescence Resonance Energy Transfer (FRET): By creating recombinant GJB2 fused to fluorescent proteins suitable for FRET analysis, researchers can investigate dynamic interactions between GJB2 and other proteins in living cells. This technique provides spatial and temporal information about protein-protein interactions.

  • Reconstitution Studies: Recombinant GJB2 can be reconstituted into liposomes or planar lipid bilayers together with putative interacting proteins to directly assess functional interactions through electrophysiological or dye transfer measurements .

  • Heteromeric Connexon Formation Analysis: Co-expression of recombinant GJB2 with other connexin family members allows for the study of heteromeric connexon formation and the resulting functional properties of these mixed channels.

What are the current challenges in achieving functional expression of recombinant GJB2 for electrophysiological studies?

Achieving functional expression of recombinant GJB2 for electrophysiological studies presents several challenges that researchers must address:

  • Protein Folding and Membrane Insertion: GJB2 is a multi-pass membrane protein that requires proper folding and insertion into the membrane. Expression systems must provide appropriate chaperones and membrane-integration machinery for functional protein production.

  • Connexon Assembly: The formation of hexameric connexons requires proper oligomerization of GJB2 monomers. Factors affecting this process include protein concentration, membrane composition, and cellular trafficking machinery.

  • Heterologous System Selection: Different expression systems offer varying advantages. While insect cell lines have been successfully used for functional expression of rat GJB2 , mammalian expression systems may provide more native-like post-translational modifications and membrane composition.

  • Channel Conductance Heterogeneity: Recombinant GJB2 channels exhibit a range of conductance values (35-45 pS, 60 pS, and 90-110 pS) . This heterogeneity complicates electrophysiological analysis and may reflect different channel conformations or post-translational modifications.

  • Reconstitution Parameters: For planar lipid bilayer studies, critical parameters include lipid composition, protein-to-lipid ratio, and buffer conditions. These factors significantly influence channel insertion efficiency and functional properties.

How might comparative studies of GJB2 from different species advance our understanding of connexin evolution and function?

Comparative studies of GJB2 from different species, including sheep, can significantly advance our understanding of connexin evolution and function through several key approaches:

What novel therapeutic approaches could be developed based on recombinant GJB2 research?

Research on recombinant GJB2 is driving the development of several innovative therapeutic approaches:

  • AAV-Mediated Base Editing Therapies: Recent advances in adenine base editing delivered via AAV vectors show promise for correcting specific GJB2 mutations. Optimization efforts have focused on developing efficient base editor variants (such as TadA8e mutants) and delivery systems for cochlear applications .

  • Connexin Mimetic Peptides: Synthetic peptides based on specific domains of GJB2 could be developed to modulate gap junction function. These peptides might enhance the function of remaining wild-type GJB2 in heterozygous mutation carriers or compensate for GJB2 deficiency.

  • Gap Junction Modulators: High-throughput screening of compound libraries using recombinant GJB2 in functional assays could identify small molecules that enhance or restore the function of mutant GJB2 proteins.

  • Gene Therapy Optimization: Understanding the structure-function relationships of GJB2 through recombinant protein studies helps in designing optimized gene therapy constructs. This includes modifications to enhance protein stability, trafficking, or function in the target tissue.

  • ATP and Calcium Signaling Modulation: Since GJB2 deficiency leads to reduced intracellular ATP levels and impaired calcium signaling , therapies targeting these downstream pathways could potentially mitigate the effects of GJB2 mutations even without restoring the protein itself.

What statistical approaches are recommended for analyzing GJB2 functional data?

When analyzing GJB2 functional data, researchers should consider the following statistical approaches:

Data TypeRecommended Statistical TestSample Size ConsiderationsNotes
Gap Junction Plaque MeasurementsKruskal-Wallis with Dunn's multiple comparisonsMinimum 40 GJPs per groupNon-parametric methods are preferred due to non-normal distribution of biological measurements
Channel ConductanceDescriptive statistics with mean ± SEMMultiple technical replicates (n ≥ 3)Report full range of conductance values observed
Editing EfficiencyMean ± SEMn ≥ 4 per groupCompare across different guide RNAs and base editor variants
Off-Target AnalysisMean ± SEM with multiple comparison correctionn ≥ 4 per siteAnalyze multiple potential off-target sites
Dye TransferArea quantification with appropriate parametric or non-parametric testsn ≥ 3 independent experimentsNormalize to controls to account for experiment-to-experiment variation

For all analyses, appropriate normalization to control conditions (such as wild-type GJB2 expression) is essential to account for experimental variation and facilitate cross-study comparisons .

How should researchers standardize and validate antibodies for sheep GJB2 detection in immunological applications?

To standardize and validate antibodies for sheep GJB2 detection, researchers should follow this comprehensive validation protocol:

  • Cross-Reactivity Testing:

    • Determine sequence homology between sheep GJB2 and the immunogen used to generate the antibody

    • Test antibody against recombinant sheep GJB2 expressed in a controlled system

    • Compare reactivity with GJB2 from other species (human, mouse, rat) to establish specificity

  • Positive and Negative Controls:

    • Use tissues known to express high levels of GJB2 (such as liver or cochlea) as positive controls

    • Use GJB2-knockout tissues or cells as negative controls

    • Include peptide competition assays to confirm binding specificity

  • Multiple Detection Methods:

    • Validate the antibody using at least three different techniques:

      • Western blotting (expected molecular weight approximately 26 kDa)

      • Immunohistochemistry/immunofluorescence (characteristic punctate staining at cell-cell contacts)

      • Immunoprecipitation followed by mass spectrometry verification

  • Reproducibility Assessment:

    • Test multiple antibody lots to ensure consistent performance

    • Document detailed protocols including antibody dilution, incubation conditions, and detection methods

  • Reporting Standards:

    • Report complete antibody information (source, catalog number, lot, dilution)

    • Include all validation data in publications or supplementary materials

This approach ensures reliable detection of sheep GJB2 and facilitates comparison across different studies.

What are the common challenges in purifying functional recombinant GJB2 and how can they be addressed?

Purifying functional recombinant GJB2 presents several challenges that can be addressed through specific strategies:

ChallengeUnderlying IssueSolution Strategy
Low Expression YieldMembrane protein toxicity to host cellsUse tightly controlled inducible expression systems; optimize induction parameters; consider specialized host strains for membrane proteins
Protein AggregationHydrophobic transmembrane domains prone to misfoldingInclude mild detergents (DDM, CHAPS) during extraction; maintain strict temperature control during purification; add stabilizing agents like glycerol
Loss of Native StructureDetergent-induced conformational changesScreen multiple detergents; use lipid nanodiscs or amphipols to provide native-like membrane environment; validate structure with circular dichroism
Decreased StabilityLoss of stabilizing interactions during purificationOptimize buffer composition (pH, ionic strength); add specific lipids that interact with GJB2; perform chromatography steps rapidly at 4°C
Oligomerization IssuesFailure to maintain hexameric connexon structureUse gentle extraction conditions; validate oligomeric state with size exclusion chromatography or native PAGE; consider crosslinking approaches
Contaminant ProteinsCo-purification of associated proteinsImplement multiple purification steps; consider tandem affinity tags; validate purity with mass spectrometry

For functional validation, recombinant GJB2 can be reconstituted into planar lipid bilayers to confirm channel activity with expected conductance properties (35-45 pS in 200 mM KCl) .

How can researchers troubleshoot inconsistent results in GJB2 mutagenesis and functional studies?

When troubleshooting inconsistent results in GJB2 mutagenesis and functional studies, researchers should systematically evaluate these key factors:

  • Expression Level Variability:

    • Quantify protein expression through Western blotting and standardize based on expression level

    • Use inducible expression systems with titratable induction to achieve consistent expression

    • Implement fluorescent protein tags for real-time monitoring of expression levels

  • Cellular Context Differences:

    • Document and control cell passage number, confluence at transfection, and time post-transfection

    • Consider the endogenous connexin profile of host cells, which may form heteromeric channels

    • Evaluate trafficking efficiency in different cell types using immunofluorescence microscopy

  • Mutation-Specific Effects:

    • Verify mutations by sequencing after each experimental manipulation

    • Create multiple independent clones for each mutation to account for clonal variation

    • Consider potential dominant-negative effects when co-expressing mutant and wild-type GJB2

  • Functional Assay Sensitivity:

    • Standardize dye transfer assay conditions including dye concentration, loading time, and analysis parameters

    • For electrophysiological studies, control for variation in membrane composition and recording conditions

    • Implement internal controls with known conductance properties in each experimental session

  • Statistical Approach:

    • Increase biological replicates (n ≥ 3 independent experiments)

    • Analyze at least 40 gap junction plaques per condition for morphological assessments

    • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.