Recombinant Sheep Lutropin-choriogonadotropic hormone receptor (LHCGR)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant sheep LHCGR is synthesized using heterologous expression systems. Data from commercial suppliers (e.g., MyBioSource) reveal:

Host SystemPurityApplications
E. coli≥85%Structural studies, ligand screening
Mammalian cells (HEK293)≥90%Functional assays, signaling studies
Baculovirus/Insect cells≥85%Large-scale production

Source:

The receptor is typically tagged (e.g., His, FLAG) for affinity chromatography purification .

Signaling Pathway Analysis

  • cAMP Dynamics: In COS-7 cells expressing recombinant LHCGR, hCG shows 5-fold higher potency than LH in cAMP production .

  • Kinase Activation: ERK1/2 and AKT pathways are differentially modulated by LH vs. hCG, influencing ovulation and luteinization .

Mutational Studies

  • Constitutive Activation: Mutants like L469R in transmembrane domains exhibit elevated basal cAMP, mimicking familial male precocious puberty .

  • C-Terminal Truncations: Deletion of phosphorylation sites (e.g., eel LH/CGR-t651) abolishes agonist-induced cAMP responses, highlighting regulatory roles of post-translational modifications .

Comparative Endocrinology

Studies in sheep LHCGR provide insights into species-specific differences in:

  • Hormone binding affinity (e.g., hCG vs. oLH) .

  • Receptor trafficking and desensitization mechanisms .

Challenges and Innovations

  • Expression Optimization: Mammalian systems (e.g., HEK293) yield functional receptors with proper glycosylation, unlike prokaryotic hosts .

  • Ligand Specificity: Structural studies using recombinant receptors have identified extracellular loop residues critical for differentiating LH and CG binding .

Future Directions

  • Therapeutic Targeting: Developing small-molecule agonists/antagonists for infertility or hormone-dependent cancers .

  • Cryo-EM Studies: Resolving full-length receptor-hormone complexes to guide drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please specify it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LHCGR; LHR; Lutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-538
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
SQSDSLEKIEANALHNLLNLSEIPIQNTKNLVYIEPGAFTNLPRLKYLSICNTGIRKLPD VTKIFSSEFNFILEICDNLHITTVPGNAFQGMNNESITLKLYGNGFEEIQSHAFNGTTLI SLELKENAHLKKMHDDAFRGARGPSILDISSTKLQALPSYGLESIQTLIATSSYSLKKLP SREKFTNLLDATLTYPSHCCAFRNLPTKEQNFSFSIFKNFSKQCESTARRPNNETLYSAI FAESELSDWDYDYGFCSPKTLQCAPEPDAFNPCEDIMGYDFLRVLIWLINILAIMGNVTV LFVLLTSHYKLTVPRFLMCNLSFADFCMGLYLLLIASVDAQTKGQCYNHAIDWQTGNGCS VAGFFTVFASELSVYTLTVITLERWHTITYAIQLDQKLRLRHAIPIMLGGWLFSTLIAML PLVGVSSYMKVSICLPMDVETTLSQVYILTILILNVVAFIIICACYIKIYFAVQNPELMA TNKDTKIAKKMAVLIFTDFTCMAPISFFAISAALKVPLITVTNSKVLLVLFYPVNSCA
Uniprot No.

Target Background

Function
Recombinant Sheep Lutropin-choriogonadotropic hormone receptor (LHCGR) acts as a receptor for lutropin-choriogonadotropic hormone. Its activity is mediated by G proteins, which activate adenylate cyclase.
Database Links

UniGene: Oar.413

Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of sheep LHCGR and how does it compare to other species?

Sheep LHCGR is a G protein-coupled receptor characterized by seven transmembrane helices, three extracellular loops, three intracellular loops, and a cytoplasmic tail. Like other mammalian LHCGRs, it contains a relatively large N-terminal extracellular domain that is critical for high-affinity hormone binding . The amino acid sequence of the sheep LHCGR shares approximately 88% identity with the rat LHR, illustrating the evolutionary conservation of this receptor across mammalian species .

The extracellular domain plays a crucial role in hormone recognition and binding, while the intracellular regions are involved in G protein activation and downstream signaling. Upon hormone binding, conformational changes occur in the receptor's structure, particularly in the extracellular loops and transmembrane domains, which trigger intracellular signaling cascades . This structure-function relationship is fundamental to understanding how different ligands can bind to the same receptor yet produce distinct physiological responses.

What are the key genomic characteristics of the sheep LHCGR gene?

The sheep LHCGR gene is closely linked to the follicle-stimulating hormone receptor (FSHR) gene on sheep chromosome 3, with no recombinants detected between these two genes in linkage studies . This genomic organization suggests that both gonadotropin receptor genes likely arose from duplication of an ancestral gene, followed by functional divergence. Both receptors show greater similarity to each other than to the thyroid-stimulating hormone receptor (TSHR), further supporting this evolutionary relationship .

Genetic analysis has revealed that these receptor genes are not linked to the Booroola fecundity gene (FecB), which is known to affect ovulation rate in sheep . This genomic arrangement of the LHCGR and FSHR genes appears to be conserved across mammalian species, as similar linkage has been observed in deer, with the two genes separated by approximately 3.3 cM . The conservation of this genomic organization across species highlights the evolutionary importance of these reproductive hormone receptors.

What are the most effective methods for expressing recombinant sheep LHCGR in mammalian cell systems?

For effective expression of recombinant sheep LHCGR in mammalian cells, transient transfection of human embryonic kidney (HEK) 293 cells has been demonstrated to be a reliable approach. A methodological framework includes cloning the LHCGR cDNA into an appropriate expression vector, such as pEGFP-N1, to create a fusion protein that can be easily detected . When designing the expression construct, incorporating a flexible linker (e.g., poly-glycine) between the LHCGR sequence and the reporter tag (such as EGFP) can help maintain proper protein folding and functionality .

Transfection can be performed using lipid-based reagents like Lipofectamine 3000, with cells typically cultured for 48 hours post-transfection to allow sufficient protein expression . To enhance expression efficiency, optimization of the DNA-to-lipid ratio is crucial, and the use of serum-free media during the transfection process can improve transfection efficiency. For stable expression, selection with appropriate antibiotics (e.g., G418 for neomycin resistance) allows for the generation of cell lines consistently expressing the receptor. Verification of expression can be performed through confocal microscopy for localization studies and Western blotting for protein expression levels.

How can researchers effectively detect and quantify sheep LHCGR expression in experimental systems?

Multiple complementary techniques can be employed to detect and quantify sheep LHCGR expression. For visualization of receptor localization, fluorescent tagging with EGFP followed by confocal microscopy provides detailed information about subcellular distribution. As demonstrated in studies with human LHCGR, wild-type receptors predominantly localize to the cell membrane, while certain mutations can cause intracellular retention .

For quantitative assessment of protein expression, Western blotting using antibodies specific to either the LHCGR protein or the fusion tag (e.g., EGFP) provides information about protein size and relative abundance. Flow cytometry can be used to quantify cell surface expression levels in intact cells, particularly useful when comparing wild-type and mutant receptors. Additionally, real-time PCR can measure LHCGR mRNA levels, offering insights into transcriptional regulation. Functional assays such as cAMP accumulation in response to hormone stimulation (using the GloSensor cAMP assay) can indirectly measure functional receptor expression by assessing signal transduction capabilities . These combined approaches provide a comprehensive assessment of receptor expression, localization, and functionality.

How do LH and hCG differentially interact with sheep LHCGR at the molecular level?

Despite binding to the same receptor, LH and hCG exhibit distinct molecular interactions with LHCGR. Research indicates that the two hormones induce different conformational changes in the receptor, leading to activation of divergent signaling pathways. While both hormones bind to the large N-terminal extracellular domain of LHCGR, studies with rat LHR have shown that LH and hCG can be discriminated by the receptor, with mature cell surface receptors binding ovine LH (oLH) with higher affinity than immature intracellular forms . This suggests structural differences in how these hormones engage with the receptor.

Human studies have identified a specific region in LHCGR capable of distinguishing between LH and hCG . Molecular evidence indicates that LH action in ovarian cells is preferentially mediated through kinase pathways (pERK1/2 and phosphorylated AKT), resulting in proliferative and antiapoptotic signals. In contrast, hCG predominantly activates cAMP/protein kinase A (PKA) pathways, leading to steroidogenic and potentially proapoptotic effects . These differences in signaling are likely due to hormone-specific conformations induced in the receptor upon binding, affecting the receptor's interaction with different G proteins and other signaling molecules.

What experimental approaches can accurately measure sheep LHCGR activation following ligand binding?

Several complementary experimental approaches can accurately measure sheep LHCGR activation. The GloSensor cAMP assay provides a real-time, kinetic measurement of cAMP production following receptor stimulation with different concentrations of hormones such as recombinant human LH (r-hLH) or human chorionic gonadotropin (hCG) . This assay allows for the detection of both the magnitude and timing of the cAMP response, which can differ between wild-type and mutant receptors.

For a comprehensive assessment of LHCGR signaling, researchers should measure multiple downstream pathways. Beyond the canonical cAMP/PKA pathway, activation of the ERK1/2 and AKT pathways can be assessed through Western blotting with phospho-specific antibodies . Calcium mobilization assays using fluorescent calcium indicators provide information about rapid signaling events. Gene expression analysis through qRT-PCR or RNA-sequencing can identify transcriptional changes induced by receptor activation. Additionally, receptor internalization and recycling, important aspects of receptor function, can be monitored through immunofluorescence or flow cytometry using antibodies against extracellular epitopes of the receptor or by tracking fluorescently tagged receptors.

How do mutations in sheep LHCGR affect ligand binding and signal transduction?

Mutations in LHCGR can profoundly impact ligand binding and signal transduction through multiple mechanisms. Studies with human LHCGR have shown that some mutations, such as the p.Ala449Thr substitution, differentially affect the receptor's response to LH versus hCG . This particular mutation reduces LH signaling at low concentrations while enhancing hCG signaling, demonstrating hormone-specific effects of receptor mutations.

Research using protein structure network analysis has identified critical communication pathways within the receptor. For example, the p.Ala449Thr mutation is spatially close to a highly conserved tryptophan residue (W491) that serves as a hub in intramolecular communication . The substitution of a hydrophobic residue (alanine) with a hydrophilic one (threonine) alters non-covalent interactions between neighboring amino acids, inducing subtle conformational changes that affect hormone binding and signal transduction differently depending on the ligand .

Some mutations cause intracellular retention of the receptor, preventing proper localization to the cell surface . Even when these mutant receptors retain the ability to bind hormones (as demonstrated in detergent-solubilized preparations), their signaling capacity is compromised due to improper cellular localization. The transition from attenuating to enhancing signaling capability observed with some mutant receptors at increasing hormone concentrations suggests that LHCGR may form higher-order complexes (homo-dimers or homo-oligomers) that work in either cis or trans configurations to transduce signals .

What cell-based assays are most appropriate for studying sheep LHCGR function?

Several cell-based assays provide complementary information about sheep LHCGR function. For signal transduction studies, the GloSensor cAMP assay in transfected HEK293 cells offers real-time monitoring of cAMP production following hormone stimulation . This system allows for precise dose-response analyses with different concentrations of hormones (e.g., 0.01, 0.1, 1, or 10 IU/ml of r-hLH or hCG) and can detect both the magnitude and kinetics of the response.

For receptor trafficking and localization studies, confocal microscopy of EGFP-tagged LHCGR in transfected cells provides valuable information about subcellular distribution patterns . This approach can distinguish between receptors properly localized to the cell membrane versus those retained intracellularly due to mutations or other factors. Flow cytometry using antibodies against extracellular epitopes offers quantitative assessment of cell surface receptor populations.

Primary cell cultures from sheep tissues (such as granulosa cells, theca cells, or Leydig cells) provide a more physiologically relevant system for studying endogenous LHCGR function, including steroidogenesis and gene expression responses. Proliferation assays in these cells can measure the growth-promoting effects of LHCGR activation. Additionally, receptor internalization assays using fluorescently labeled ligands or antibodies can track receptor dynamics following hormone binding, providing insights into desensitization and recycling mechanisms that regulate receptor responsiveness.

How can researchers design experiments to compare LH and hCG effects on sheep LHCGR?

To effectively compare LH and hCG effects on sheep LHCGR, researchers should employ a multi-faceted experimental approach that addresses both the quantitative and qualitative differences in receptor responses. Concentration-matched experiments are essential, testing a range of hormone concentrations (from physiological to supraphysiological) to capture the full spectrum of responses. Commonly used concentrations include 0.01, 0.1, 1, and 10 IU/ml for both hormones .

Time-course experiments are crucial for detecting differences in the kinetics of response. As demonstrated with mutant human LHCGR, the mutant receptor responded more slowly to hCG at physiological concentrations (0.01 IU/ml) but showed higher cAMP levels after 30 minutes compared to wild-type . Measurements should be taken at multiple time points (e.g., every 10 seconds for rapid responses, and at longer intervals for sustained effects) to capture these temporal differences.

Multiple signaling pathways should be assessed simultaneously, including the canonical cAMP/PKA pathway along with ERK1/2 and AKT phosphorylation. Research has shown that LH and hCG can preferentially activate different pathways, with LH favoring kinase pathways (ERK1/2 and AKT) while hCG shows stronger activation of cAMP/PKA signaling . Downstream functional outcomes should also be measured, including steroidogenesis (progesterone, estradiol, testosterone production), gene expression changes, proliferation/apoptosis, and receptor internalization/desensitization. This comprehensive approach will provide a detailed comparison of how these two hormones interact with and signal through sheep LHCGR.

What role do the extracellular loops of sheep LHCGR play in ligand binding and receptor activation?

The extracellular loops (ECLs) of sheep LHCGR play critical roles in both ligand binding and receptor activation. Research with rat LHR has shown that deletions of portions of the extracellular loops result in receptors that are retained intracellularly, indicating that these domains are essential for proper receptor folding and trafficking . While the large N-terminal extracellular domain is the primary site of high-affinity hormone binding, the ECLs contribute to subsequent steps in the activation process.

Upon hormone binding to the N-terminal domain, a portion of the hormone or the receptor's extracellular domain is hypothesized to interact with the receptor's extracellular loops and/or transmembrane helices, triggering an intracellular conformational change that initiates signaling . This "two-step" model of activation involves initial hormone binding followed by signal propagation through the ECLs to the transmembrane domains. Interestingly, even when ECL deletion mutants are solubilized in detergent, they show altered binding properties for ovine LH compared to wild-type receptors, suggesting that the ECLs specifically contribute to LH recognition and binding .

Studies have demonstrated that ECL deletion mutants retain the ability to bind human chorionic gonadotropin (hCG) with high affinity even when solubilized, but show altered binding characteristics for ovine LH . This differential effect suggests that the ECLs may be particularly important for discriminating between different ligands that act on the same receptor. The specific amino acid sequences within the ECLs likely form distinct interaction interfaces with different hormones, contributing to the observed differences in signaling outcomes between LH and hCG.

How do transmembrane domains contribute to sheep LHCGR function and signal transduction?

The transmembrane domains (TMDs) of sheep LHCGR form the structural core of the receptor and play essential roles in signal transduction following hormone binding. These seven alpha-helical domains span the cell membrane and undergo conformational changes that couple extracellular hormone binding to intracellular G protein activation. Analysis of human LHCGR has identified a critical intramolecular communication path that connects the extracellular hormone-binding region to the intracellular signaling domains, with several key residues in the TMDs serving as important nodes in this network .

Specific residues within the TMDs create a network of non-covalent interactions that stabilize the receptor in its inactive state and facilitate transition to the active conformation upon hormone binding. For example, the highly conserved tryptophan residue W491 in Helix 4 serves as a hub in the intramolecular communication pathway . Mutations near this residue, such as p.Ala449Thr, can affect non-covalent interactions between neighboring amino acids (F448, L452, and W491) and induce subtle conformational changes that alter receptor activation in a hormone-specific manner .

The arrangement of the TMDs also creates binding pockets for G proteins and other signaling molecules on the intracellular side of the receptor. Different conformational states of the TMDs may preferentially interact with different G protein subtypes (Gs vs. Gq/11) or other signaling partners, explaining how LH and hCG can activate distinct signaling pathways despite binding to the same receptor . Additionally, the TMDs contribute to receptor dimerization or oligomerization, which may be important for signal amplification and diversification. Evidence suggests that LHCGR can form higher-order complexes that operate in either cis or trans configurations depending on hormone concentration and receptor density .

How can CRISPR/Cas9 technology be applied to study sheep LHCGR function?

CRISPR/Cas9 technology offers powerful approaches for studying sheep LHCGR function through precise genetic manipulation. For in vitro studies, CRISPR/Cas9 can be used to introduce specific mutations identified in human patients (such as p.Ala449Thr) into sheep LHCGR expressed in cell culture systems . This allows direct comparison of how these mutations affect receptor function across species. Complete knockout of LHCGR in cell lines provides negative controls for antibody validation and background signal assessment in functional assays.

For more sophisticated models, CRISPR/Cas9 can generate knock-in modifications that add reporter tags (such as fluorescent proteins or epitope tags) to the endogenous LHCGR, enabling tracking of the native receptor without overexpression artifacts. Base editing or prime editing technologies allow introduction of precise single nucleotide changes to study how specific amino acid substitutions affect receptor function without creating double-strand breaks.

For in vivo applications, CRISPR/Cas9 could potentially be used to generate sheep models with modified LHCGR genes, although ethical and practical considerations make this challenging. Alternatively, CRISPR/Cas9-modified sheep granulosa or theca cells cultured ex vivo provide a more accessible model system. Domain swap experiments, where regions of sheep LHCGR are replaced with corresponding regions from other species (or vice versa), can identify species-specific functional domains. Finally, CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) systems allow modulation of endogenous LHCGR expression without altering the genetic sequence, providing insights into how expression levels affect receptor function.

What are the most promising approaches for developing functional studies of sheep LHCGR in primary ovarian cells?

Developing functional studies of sheep LHCGR in primary ovarian cells requires specialized approaches that maintain cellular integrity while allowing detailed receptor analysis. Isolation and culture protocols for sheep granulosa and theca cells should be optimized to preserve LHCGR expression and function, typically using enzymatic digestion (collagenase/hyaluronidase) of ovarian follicles followed by filtration and centrifugation steps to purify specific cell populations. Media supplementation with serum substitutes rather than fetal bovine serum can reduce variability, and addition of insulin, transferrin, and selenium maintains cell viability while minimizing background hormonal stimulation.

For functional assays, stimulation of primary cells with physiologically relevant concentrations of ovine LH or hCG (0.01-10 IU/ml) followed by measurement of multiple endpoints provides comprehensive assessment of LHCGR function . Key parameters to measure include steroidogenic responses (progesterone and estradiol production via radioimmunoassay or ELISA), cAMP production, and phosphorylation of ERK1/2 and AKT. Cell proliferation can be assessed using CFSE labeling and flow cytometry, as demonstrated in sheep T cell studies .

Advanced approaches include single-cell analysis techniques to address cellular heterogeneity, such as single-cell RNA sequencing to identify LHCGR-expressing subpopulations and their differential responses to hormone stimulation. Microfluidicdystems allow precise control of hormone gradients and temporal patterns of stimulation, better mimicking physiological conditions. Co-culture systems incorporating multiple ovarian cell types (granulosa, theca, and oocytes) provide a more complete physiological context for LHCGR function. Finally, patient-derived mutations can be introduced into sheep LHCGR in primary cells using CRISPR/Cas9 to create clinically relevant experimental models for reproductive disorders.

How does sheep LHCGR compare structurally and functionally with LHCGR from other ruminants and non-ruminant species?

Sheep LHCGR shares significant structural and functional similarities with other ruminant species while displaying notable differences compared to non-ruminants. Genomic organization studies have shown that in both sheep and deer, the LHCGR and FSHR genes are closely linked, with map distances of 0 cM in sheep and 3.3 cM in deer . This conserved genomic arrangement suggests similar evolutionary pathways across ruminant species.

Sequence comparisons indicate that mammalian LHCGRs (including sheep) and FSHRs are more similar to each other than to mammalian TSH receptors, suggesting that TSHR and the ancestral LHCGR/FSHR diverged first, followed by duplication and functional divergence of LHCGR and FSHR . The sheep LHCGR shares approximately 88% sequence identity with rat LHR, highlighting substantial conservation across mammalian orders .

A key functional difference exists between primates and non-primate mammals: primates produce both LH and chorionic gonadotropin (CG), which act on the same receptor but regulate different physiological events, while non-primates like sheep produce only LH . Primates have undergone separate evolution of LHβ and hCGβ subunits, resulting in two molecules sharing ~85% identity but with distinct physiological roles . This evolutionary difference has implications for how research findings from sheep models translate to human applications, particularly in reproductive medicine and contraceptive development.

What evolutionary insights can be gained from studying sheep LHCGR compared to other species?

Studying sheep LHCGR in comparison with other species provides valuable evolutionary insights into reproductive hormone signaling systems. The close linkage between LHCGR and FSHR genes in sheep and deer (at distances of 0 cM and 3.3 cM respectively) suggests that these two gonadotropin receptors arose from duplication of an ancestral gene followed by functional divergence . This genomic organization appears to be evolutionarily conserved across mammalian species, highlighting the fundamental importance of these receptors in reproductive physiology.

Sequence analysis has revealed that mammalian LHCGRs and FSHRs exhibit greater similarity to each other than to mammalian TSH receptors . This pattern suggests a specific evolutionary history: an ancestral glycoprotein hormone receptor gene likely underwent duplication, with one copy evolving into TSHR and the other into the precursor of LHCGR/FSHR. Subsequently, a second duplication event of the LH/FSH receptor precursor, followed by functional divergence, gave rise to the two distinct gonadotropin receptors present in mammals today .

A significant evolutionary divergence exists between primates and non-primates like sheep. Primates have separate LHβ and hCGβ subunits that evolved distinctly despite acting on the same receptor, while sheep and other non-primates produce only LH . This primate-specific adaptation allowed for specialized hormone functions: pituitary LH with a short half-life (~90 minutes) regulating gametogenesis and androgen synthesis, and placental hCG with a long half-life (hours) supporting pregnancy maintenance . The absence of CG in sheep reflects different evolutionary strategies for maintaining pregnancy across mammalian lineages, with progesterone production in sheep relying on mechanisms not dependent on CG. These evolutionary differences must be considered when extrapolating findings from sheep models to human reproductive biology.

What are common technical challenges in expressing and characterizing sheep LHCGR, and how can they be addressed?

Researchers working with sheep LHCGR face several technical challenges that require specific methodological refinements. Low expression levels can hamper functional studies, particularly with certain mutant receptors. This can be addressed by optimizing codon usage for the expression system, using stronger promoters (such as CMV or CAG), and including Kozak consensus sequences to enhance translation initiation. Adding chaperone proteins as co-expression partners can assist with proper folding of complex transmembrane proteins like LHCGR.

Improper receptor trafficking is another common issue, especially with mutant receptors that may be retained intracellularly . Temperature-sensitive folding can be exploited by culturing cells at lower temperatures (30-32°C) to allow more complete folding before trafficking. Chemical chaperones such as 4-phenylbutyrate or glycerol can also promote proper folding and trafficking of some mutant receptors. For detection purposes, using dual tagging strategies (e.g., N-terminal Flag tag and C-terminal EGFP) can distinguish between full-length receptors and truncated products.

Non-specific antibody binding presents challenges for immunodetection. Thorough validation of antibodies using LHCGR knockout controls is essential, and epitope tags (HA, Flag, etc.) can provide alternative detection strategies when specific antibodies are unavailable. Receptor heterogeneity due to differential glycosylation can complicate interpretation of Western blots; enzymatic deglycosylation (PNGase F treatment) before analysis can simplify banding patterns. Finally, constitutive activity or ligand-independent activation can mask ligand-specific effects in functional assays. Using inverse agonists or conducting experiments in serum-free conditions can minimize background activity, while including appropriate time-matched controls accounts for any constitutive signaling.

How can researchers optimize signaling assays to detect subtle differences in sheep LHCGR activation by different ligands?

Optimizing signaling assays to detect subtle differences in sheep LHCGR activation requires attention to multiple experimental parameters. Temporal resolution is critical, as demonstrated by the differential kinetics observed with wild-type versus mutant human LHCGR responses to hormones . Real-time assays like the GloSensor cAMP system allow continuous monitoring at 10-second intervals over extended periods (60+ minutes), capturing both rapid initial responses and sustained signaling phases . This high temporal resolution can reveal differences that might be missed with single time-point measurements.

Dose optimization across a wide concentration range (0.01-10 IU/ml) is essential, as some LHCGR mutations show concentration-dependent shifts from attenuated to enhanced signaling compared to wild-type receptors . Using purified, well-characterized hormone preparations with defined bioactivity is critical for reproducible results. Assessing multiple signaling pathways simultaneously provides a more complete picture of receptor activation patterns. Beyond the canonical cAMP/PKA pathway, measuring ERK1/2 and AKT phosphorylation can reveal biased signaling, where different ligands preferentially activate distinct downstream pathways despite binding to the same receptor .

Single-cell analysis techniques help address cellular heterogeneity in mixed populations, as not all cells express equal levels of receptor or respond identically. Microfluidic systems allow precise control of hormone concentrations and timing, better mimicking physiological conditions. For challenging receptor variants with low expression or altered trafficking, signal amplification techniques such as the proximity ligation assay (PLA) can detect protein-protein interactions with greater sensitivity than conventional co-immunoprecipitation. Finally, BRET/FRET-based biosensors provide spatiotemporal information about signaling events in live cells, revealing compartmentalized signaling that may differ between ligands.

What statistical approaches are most appropriate for analyzing concentration-response data from sheep LHCGR signaling studies?

Analyzing concentration-response data from sheep LHCGR signaling studies requires appropriate statistical approaches to accurately interpret receptor pharmacology. Nonlinear regression analysis using the four-parameter logistic equation (Hill equation) is the foundation for fitting sigmoidal concentration-response curves, yielding key parameters including EC50 (potency), Emax (efficacy), Hill slope (cooperativity), and basal response. Comparison between different ligands or receptor variants should include statistical tests (F-test) to determine if curves differ significantly in these parameters.

Area under the curve (AUC) analysis provides a comprehensive measure of the total response over the entire concentration range, which is particularly valuable when comparing hormones that may differ in both potency and efficacy. Time-course data, such as that generated by the GloSensor cAMP assay with readings every 10 seconds , should be analyzed using repeated measures ANOVA or mixed-effects models to account for the non-independence of measurements from the same sample over time.

For complex signaling patterns, such as the transition from attenuated to enhanced signaling seen with the p.Ala449Thr mutation at different LH concentrations , segmental analysis of the concentration-response curve may be necessary, fitting separate models to different portions of the curve. Biased signaling analysis using operational models can quantify ligand bias between different pathways (e.g., cAMP vs. ERK1/2). When comparing multiple experimental conditions (different ligands, receptor variants, and pathways), multivariate approaches such as principal component analysis or partial least squares discriminant analysis can identify patterns that may not be apparent from univariate comparisons.

How should researchers interpret differences in sheep LHCGR activation patterns between LH and hCG?

Interpreting differences in sheep LHCGR activation patterns between LH and hCG requires careful consideration of multiple factors. Ligand-specific conformational changes in the receptor likely underlie differential signaling patterns, as suggested by studies showing that LH preferentially activates kinase pathways (ERK1/2 and AKT) while hCG shows stronger activation of cAMP/PKA pathways . These different "conformational ensembles" induced by each hormone may favor interaction with distinct subsets of intracellular signaling partners.

Temporal dynamics of the response provide important interpretive context. The p.Ala449Thr mutation in human LHCGR, for example, causes a slower initial response to hCG at physiological concentrations (0.01 IU/ml) but higher cAMP levels after 30 minutes compared to wild-type receptor . This suggests that kinetic parameters (time to peak response, duration of signaling) may be as important as the magnitude of the response in determining physiological outcomes.

Concentration dependence adds another layer of complexity. The transition from attenuating to enhancing signaling capability observed with some mutant receptors at increasing hormone concentrations suggests that LHCGR may form higher-order complexes (homo-dimers or homo-oligomers) that operate in cis or trans configurations depending on receptor occupancy . At low hormone concentrations, receptors may work through trans-activation mechanisms, while at higher concentrations, cis-activation may predominate. This model would predict different sensitivity to hormone concentration between LH and hCG due to their distinct binding properties.

Physiological context is essential for interpreting in vitro findings. The biological significance of differential signaling is supported by clinical data from assisted reproduction, where hCG's stronger steroidogenic potential positively affects the number of retrieved oocytes, while LH affects the pregnancy rate per oocyte number . Species differences must also be considered, as sheep do not produce CG, and the sheep LHCGR might be evolutionarily optimized for LH signaling compared to the human receptor, which must accommodate both hormones.

What are the most promising research avenues for understanding sheep LHCGR structure-function relationships?

Several promising research avenues could advance our understanding of sheep LHCGR structure-function relationships. Cryo-electron microscopy (cryo-EM) of the full-length sheep LHCGR in complex with ovine LH would provide unprecedented structural insights, building on recent successes with other G protein-coupled receptors. This approach could reveal the specific conformational changes induced by hormone binding and identify key interaction interfaces between the receptor's domains. Complementary approaches like hydrogen-deuterium exchange mass spectrometry (HDX-MS) would map conformational dynamics and structural changes upon ligand binding.

Molecular dynamics simulations, particularly leveraging advanced computing resources, could model the receptor's conformational landscape and predict how different mutations affect structure and function. As demonstrated with human LHCGR, protein structure network analysis can identify critical communication pathways between extracellular hormone binding sites and intracellular signaling domains . These computational approaches can generate testable hypotheses about how specific amino acids contribute to receptor function.

Domain-swapping experiments between sheep LHCGR and other species' receptors (or between LHCGR and FSHR) would help identify regions responsible for hormone specificity and signal transduction. GPCR biosensors using BRET/FRET technologies could provide real-time visualization of conformational changes in living cells. Deep mutational scanning combined with high-throughput functional assays would systematically assess how thousands of mutations affect receptor function, creating a comprehensive map of structure-function relationships. Finally, investigations of LHCGR higher-order complex formation through techniques like BRET saturation assays would clarify the role of receptor oligomerization in signal transduction.

How might research on sheep LHCGR contribute to broader understanding of reproductive physiology and pathology?

Research on sheep LHCGR can make significant contributions to the broader understanding of reproductive physiology and pathology. Sheep serve as valuable models for reproductive studies due to their similar ovarian physiology to humans (mono-ovulatory, with similar follicular dynamics) and their importance in agricultural breeding programs. Detailed characterization of sheep LHCGR structure, function, and regulation provides comparative insights into conserved and species-specific aspects of gonadotropin signaling.

Understanding the molecular basis of LHCGR mutations and their effects on receptor function can help elucidate mechanisms underlying reproductive disorders. For example, the p.Ala449Thr mutation in human LHCGR differentially affects responses to LH versus hCG, with reduced LH signaling at low concentrations but enhanced hCG signaling . Such molecular insights help explain conditions like empty follicle syndrome, where mutations in LHCGR impair ovulation despite normal follicular development.

Comparative studies between sheep and primates highlight important evolutionary adaptations, such as the development of chorionic gonadotropin in primates. While both LH and hCG bind to the same receptor, they regulate different physiological events, with LH controlling gametogenesis and androgen synthesis and hCG supporting pregnancy maintenance . Understanding these ligand-specific effects provides insights into reproductive strategies across mammalian species.

Research on sheep LHCGR also has practical applications in improving reproductive technologies for both veterinary and human medicine. Optimizing ovarian stimulation protocols based on molecular understanding of LHCGR signaling could enhance outcomes in assisted reproduction. Additionally, the development of novel contraceptives targeting specific aspects of LHCGR function represents another important application of this research. Finally, investigating how environmental factors (such as endocrine disruptors) impact LHCGR function could help address declining fertility rates observed in many populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.