Recombinant Sheep Lysophosphatidic acid receptor 1 (LPAR1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Basis

LPAR1 is encoded by the LPAR1 gene, which spans seven transmembrane domains (TMDs) and contains 364 amino acids in its native form . The recombinant sheep variant retains this structural framework, with key features including:

  • Extracellular loops (ECL1–3): Critical for ligand binding, particularly residues Arg-124, Gln-125, and Lys-294 .

  • Intracellular loops (ICL1–3): Mediate G protein coupling (Gαi/o, Gαq/11, Gα12/13) and downstream signaling .

  • C-terminal tail: Contains PDZ-binding, Ser/Thr phosphorylation, and dileucine motifs for receptor internalization and trafficking .

The recombinant protein is typically fused with tags such as His or GST for purification and detection .

Production and Expression Systems

Recombinant sheep LPAR1 is produced using heterologous expression systems. Key platforms include:

Expression SystemHostTagPurityApplications
E. coliBacterialHis-tag>90%Structural studies, ELISA
HEK293 cellsMammalianFc-tag>95%Functional assays
Wheat GermCell-freeNon-tagged>85%Antibody production

Data sourced from Creative BioMart and NCBI .

The full-length sheep LPAR1 (UniProt ID: P46628) is expressed with a 393-amino acid sequence, including the native signal peptide and post-translational modifications .

Functional Roles and Signaling Mechanisms

Recombinant sheep LPAR1 retains the biological activity of its native counterpart, enabling researchers to study:

Angiogenesis and Cytokine Regulation

  • In liver sinusoidal endothelial cells (LSECs), LPAR1 activation by LPA upregulates Cyr61 (angiogenic factor) and SDF-1 (chemokine) via Gαi-mediated pathways .

  • LPAR1/3 dual antagonism (e.g., Ki16425) inhibits LPA-induced expression of TIMP-1 and CXCL16, highlighting receptor-specific signaling .

Cellular Proliferation and Migration

  • LPAR1 promotes Rho GTPase activation, leading to cytoskeletal reorganization and cell migration .

  • In cancer models, LPAR1 enhances tumor cell invasion via AKT and MAPK pathways .

Reproductive and Developmental Functions

  • In bovine endometrium, LPAR1 regulates prostaglandin secretion, impacting embryo implantation and uterine function .

  • Knock-in mouse studies (Lpar1-EGFP) reveal LPAR1 expression in neural progenitors and oligodendrocytes, critical for brain development .

Research Applications

Recombinant sheep LPAR1 is utilized in:

  1. Drug Discovery: Screening for LPAR1 antagonists (e.g., fibrosis inhibitors) .

  2. Disease Modeling: Studying LPAR1’s role in pulmonary fibrosis, spinal stenosis, and cancer metastasis .

  3. Structural Biology: Mapping ligand-binding domains using mutagenesis (e.g., Thr-236 in ICL3) .

Key Research Findings

  • LPAR1 in Liver Regeneration: LPA-LPAR1 signaling enhances angiogenic factors (e.g., Cyr61) in LSECs, suggesting therapeutic potential for liver injury .

  • Cancer Metastasis: LPAR1 overexpression in breast cancer correlates with elevated Rho GTPase activity and invasive phenotypes .

  • Neurodevelopmental Roles: LPAR1 knockout mice exhibit craniofacial defects and impaired oligodendrocyte maturation .

Challenges and Future Directions

  • Antibody Specificity: Existing LPAR1 antibodies show cross-reactivity with LPAR2/3, necessitating recombinant proteins for validation .

  • Therapeutic Targeting: Dual LPAR1/3 inhibitors (e.g., BMS-986020) are in clinical trials for idiopathic pulmonary fibrosis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
LPAR1; EDG-2; EDG2; LPA1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MAAASTSSPVVSQPQFTAMNEPQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTTVTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENTSGPTEGSDRSASSLNHTILAGVHSND HSVFRKETKMRGGHHLLRDEQPPPPERPGQGRV
Uniprot No.

Target Background

Function
Lysophosphatidic acid receptor 1 (LPAR1) acts as a receptor for lysophosphatidic acid (LPA). It plays a crucial role in reorganizing the actin cytoskeleton, cell migration, differentiation, and proliferation. This contributes to the responses to tissue damage and infectious agents. LPAR1 activates downstream signaling cascades through the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Signaling inhibits adenylyl cyclase activity, reducing cellular cAMP levels. It also triggers an increase in cytoplasmic Ca(2+) levels. LPAR1 activates RALA, leading to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate. Signaling mediates the activation of downstream MAP kinases. LPAR1 contributes to the regulation of cell shape. It promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction. Furthermore, it promotes the activation of Rho and the formation of actin stress fibers. LPAR1 promotes the formation of lamellipodia at the leading edge of migrating cells via activation of RAC1. Through its function as a lysophosphatidic acid receptor, LPAR1 plays a role in chemotaxis and cell migration, including responses to injury and wounding. It also plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14. LPAR1 promotes cell proliferation in response to lysophosphatidic acid. It is required for normal skeleton development and may play a role in osteoblast differentiation. LPAR1 is essential for normal brain development and for the proliferation, survival, and maturation of newly formed neurons in the adult dentate gyrus. It plays a role in pain perception and in the initiation of neuropathic pain.
Database Links

KEGG: oas:443346

UniGene: Oar.533

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell surface. Cell membrane; Multi-pass membrane protein. Endosome.
Tissue Specificity
Detected in brain cortex and in pituitary pars tuberalis.

Q&A

What is the structural composition of sheep LPAR1 and how does it compare to human LPAR1?

Lysophosphatidic acid receptor 1 (LPAR1) belongs to the G protein-coupled receptor (GPCR) family and consists of seven transmembrane domains with extracellular N-terminus and intracellular C-terminus regions. While specific sheep LPAR1 structure has limited direct characterization in current literature, comparative analyses can be extrapolated from mammalian LPAR1 studies. LPAR1 demonstrates high conservation across mammalian species, particularly in the transmembrane regions and ligand-binding domains. Researchers should note that LPAR1 has been extensively studied in mouse models, where it was first identified in embryonic brain tissue . When working with recombinant sheep LPAR1, sequence alignment with human and mouse variants is recommended to identify conserved functional domains and potential species-specific variations that might influence experimental outcomes.

What expression systems are optimal for producing recombinant sheep LPAR1?

The selection of an appropriate expression system for recombinant sheep LPAR1 depends on experimental requirements for protein folding, post-translational modifications, and functional activity. Mammalian expression systems (particularly HEK293 or CHO cells) generally provide the most physiologically relevant environment for GPCR expression. These systems ensure proper protein folding, glycosylation patterns, and membrane insertion critical for LPAR1 functionality. Baculovirus-insect cell systems represent an alternative that balances higher protein yields with mammalian-like post-translational modifications. Researchers should implement strategies to overcome the challenges of expressing membrane proteins, including using fusion tags (such as EGFP) to monitor expression efficiency and facilitate purification, similar to the approach used in mouse LPAR1-EGFP fusion studies . The fusion of EGFP to LPAR1 has been successfully demonstrated to maintain receptor functionality while enabling visualization, suggesting this approach may be viable for sheep LPAR1 expression studies.

What methods are recommended for detecting LPAR1 expression in tissue samples?

Detection of native LPAR1 in tissue samples presents significant challenges due to biologically low receptor expression levels and variable antibody specificity issues . A multi-method approach is recommended for comprehensive detection:

  • qRT-PCR: For quantitative assessment of LPAR1 mRNA expression in tissues, similar to approaches used to detect LPAR1 mRNA in liver sinusoidal endothelial cells . This method provides high sensitivity but does not confirm protein expression or localization.

  • Western blotting: Using validated antibodies against conserved LPAR1 epitopes, though researchers should be aware of potential cross-reactivity issues.

  • Immunohistochemistry/Immunofluorescence: For localization studies, though careful validation is essential due to antibody specificity concerns.

  • Reporter systems: When working with transgenic models, EGFP-fusion constructs have proven valuable for direct visualization of LPAR1 expression patterns in living tissues . This approach allows for dynamic studies of receptor trafficking and localization.

  • Functional assays: Calcium flux assays can be used to detect functional LPAR1 responses to LPA stimulation, as demonstrated in studies with systemic sclerosis dermal fibroblasts .

How can researchers effectively study LPAR1 signaling pathways in sheep cells?

Investigating LPAR1 signaling pathways requires sophisticated approaches that can capture both immediate receptor activation and downstream effects. LPAR1 couples predominantly to Gα12/13, Gαi/o, and Gαq proteins, activating multiple signaling cascades. For comprehensive analysis of sheep LPAR1 signaling, researchers should implement:

  • Calcium flux assays: To measure immediate receptor activation upon LPA binding, as demonstrated in studies of LPAR1 in systemic sclerosis dermal fibroblasts . These assays can be performed using fluorescent calcium indicators like Fluo-4 AM.

  • RhoA activation assays: To assess Gα12/13-mediated signaling, which is critical for cytoskeletal reorganization and cell migration. RhoA activity is particularly relevant as it mediates contractile responses and cell steering .

  • Phosphorylation analysis: To detect activation of downstream kinases including MAPK/ERK, PI3K/Akt, and p38 using phospho-specific antibodies in Western blotting.

  • Transcriptional profiling: To identify LPA-responsive genes regulated through LPAR1 activation. This approach can reveal tissue-specific transcriptional programs, similar to studies that identified LPA-regulated expression profiles of angiogenic factors, cytokines, and chemokines in liver sinusoidal endothelial cells .

  • Selective antagonists: Utilizing LPAR1-specific antagonists like SAR100842 or ki16425 to confirm receptor-specific effects by demonstrating inhibition of LPA-induced responses .

When designing these experiments, it is crucial to include appropriate controls, time-course analyses, and dose-response studies to fully characterize the signaling dynamics of sheep LPAR1.

What strategies can be employed to study LPAR1 trafficking and internalization?

LPAR1 trafficking represents a critical regulatory mechanism controlling receptor availability and signaling duration. Recent studies have identified important molecular players in this process, including N-WASP as a crucial mediator of LPAR1 trafficking toward recycling versus degradation pathways . To investigate these processes in sheep LPAR1, researchers should consider:

  • Fluorescence-based trafficking assays: Utilizing recombinant sheep LPAR1-EGFP fusion proteins to directly visualize receptor localization and movement in real-time, similar to the approach used in mouse studies . This method allows for the monitoring of receptor internalization, recycling, and degradation pathways.

  • Biotinylation assays: For quantitative assessment of surface receptor levels before and after LPA stimulation.

  • Co-immunoprecipitation studies: To identify trafficking-related protein interactors, particularly focusing on N-WASP and other endosomal sorting machinery components that have been implicated in LPAR1 recycling .

  • Pharmacological inhibitors: Employing specific inhibitors of endocytosis, recycling, and degradation pathways to delineate the trafficking routes of LPAR1 following agonist stimulation.

  • Mutational analysis: Generating sheep LPAR1 variants with alterations in potential trafficking motifs to identify sequences essential for proper receptor movement within the cell.

Understanding LPAR1 trafficking mechanisms is particularly relevant as evidence suggests that receptor recycling is critical for sustained responses to LPA gradients and plays a key role in cell migration and invasion processes .

What are the optimal approaches for studying LPAR1-mediated chemotaxis and migration?

LPAR1 plays a significant role in directing cell migration through chemotactic responses to LPA gradients. This has important implications in processes like wound healing, tumor invasion, and metastasis . For robust analysis of sheep LPAR1-mediated chemotaxis, researchers should consider:

  • Chemotaxis chambers: Systems like the Insall chamber used in pancreatic cancer studies provide direct visualization and quantification of directed cell movement in response to LPA gradients .

  • Time-lapse microscopy: For tracking individual cell trajectories, allowing computation of parameters such as chemotactic index, directionality, and migration speed.

  • Transwell migration assays: As a complementary approach to assess population-level migration responses.

  • Self-generated gradient studies: Particularly important as cells expressing LPAR1 can create their own LPA gradients through local degradation, driving directional migration . This requires specialized experimental designs that account for both exogenously added and endogenously generated gradients.

  • 3D migration models: Incorporating extracellular matrix components to better mimic physiological contexts, especially relevant when studying LPAR1's role in matrix remodeling and invasion.

For validation of LPAR1-specific effects, selective antagonists like ki16425 or SAR100842 should be employed to demonstrate inhibition of chemotactic responses . Additionally, knockdown/knockout controls provide critical evidence for receptor specificity in observed migration phenotypes.

How can recombinant sheep LPAR1 be utilized in fibrosis research models?

Fibrosis represents a significant area of LPAR1 research, with substantial evidence supporting its role in multiple fibrotic conditions. For researchers interested in utilizing recombinant sheep LPAR1 in fibrosis models, several approaches warrant consideration:

  • Cell-based fibrosis models: Dermal fibroblasts expressing sheep LPAR1 can be stimulated with LPA to induce myofibroblast differentiation, as demonstrated in systemic sclerosis studies . Key readouts include α-smooth muscle actin expression, collagen production, and pro-fibrotic cytokine secretion.

  • Ex vivo tissue culture models: Skin explants or precision-cut tissue slices can be utilized to study LPAR1-mediated fibrotic responses in a more complex tissue environment while maintaining cellular interactions.

  • Transgenic animal models: While not directly using recombinant protein, the generation of sheep LPAR1-EGFP knock-in animals (similar to mouse models ) would allow for visualization of receptor expression during fibrotic progression.

  • Therapeutic intervention studies: Recombinant sheep LPAR1 can serve as a screening platform for testing novel LPAR1 antagonists before in vivo application. The efficacy of such antagonists in reversing established fibrosis has been demonstrated in mouse models, where SAR100842 consistently reversed dermal thickening, inhibited myofibroblast differentiation, and reduced skin collagen content .

When designing these studies, researchers should monitor both inflammatory markers and Wnt pathway activation, as these have been implicated in LPAR1-mediated fibrotic processes . The combination of in vitro and in vivo approaches provides complementary insights into the therapeutic potential of LPAR1 targeting in fibrotic conditions.

What is the significance of LPAR1 in liver regeneration and how can it be studied?

LPAR1 has emerged as an important mediator in liver regeneration processes, with implications for both normal tissue repair and pathological conditions. Studies have shown that LPAR1 is expressed in liver sinusoidal endothelial cells (LSECs) , which play critical roles during liver regeneration. For researchers studying sheep LPAR1 in this context, several experimental approaches can be considered:

  • LSEC isolation and culture: Primary sheep LSECs can be isolated using CD31-coated magnetic beads following protocols similar to those established for mouse cells . Purity verification through flow cytometry analysis of CD31 and CD45 expression is essential.

  • LPA stimulation assays: Treating isolated LSECs with physiological levels of LPA while monitoring the expression of angiogenesis-related proteins, cytokines, and chemokines through protein arrays and enzyme immunoassays .

  • Partial hepatectomy models: In vivo models of liver regeneration where changes in LPAR1 expression and downstream signaling can be monitored at different time points post-surgery.

  • Inhibitor studies: Using LPAR1 antagonists like ki16425 to assess the functional importance of LPA signaling in regenerative processes .

The following table summarizes key factors regulated by LPA through LPAR1 in liver sinusoidal endothelial cells that may be relevant to liver regeneration studies:

CategoryFactors Enhanced by LPAInhibited by LPAR1/3 AntagonistFunction in Liver Regeneration
Angiogenic Factorscyr61, TIMP-1YesPromotion of vascular remodeling and matrix regulation
CytokinesSDF-1, C5/C5a, M-CSFSDF-1 (Yes), C5/C5a and M-CSF (No)Recruitment of stem cells and inflammatory regulation
ChemokinesMCP-5, gp130, CCL28, CXCL16YesLeukocyte recruitment and inflammatory signaling

This research direction is particularly promising as most of the factors enhanced by LPA through LPAR1 signaling have been found to play critical roles during liver regeneration .

How does LPAR1 contribute to cancer progression and what methodologies can assess this function?

LPAR1 has been implicated in various aspects of cancer biology, particularly in tumor cell invasion and metastasis . For researchers investigating sheep LPAR1 in cancer contexts, several methodological approaches should be considered:

  • Receptor expression profiling: Analyzing LPAR1 expression levels in normal versus tumor tissues using qRT-PCR, Western blotting, and immunohistochemistry. This provides baseline information on receptor abundance in different cancer types.

  • Migration and invasion assays: Utilizing Boyden chambers, scratch assays, or more sophisticated chemotaxis chambers to assess LPAR1-mediated migration and invasion in response to LPA gradients .

  • Matrix remodeling assessments: Since LPAR1 controls contractility and matrix remodeling capabilities , collagen contraction assays and matrix degradation assays provide functional readouts of these processes.

  • Trafficking studies: Examining LPAR1 recycling versus degradation pathways, particularly focusing on the role of N-WASP in coordinating receptor trafficking back to the cell surface after internalization .

  • In vivo metastasis models: While typically performed in mouse models, these provide essential information on LPAR1's role in tumor dissemination. Evidence suggests that LPAR1 enables tumor cells to respond to self-generated gradients of LPA, driving tumor egress .

  • Therapeutic targeting studies: Evaluating the effects of LPAR1 antagonists on cancer cell behavior, particularly focusing on invasion and metastasis endpoints.

Researchers should note the connection between LPAR1 trafficking and RhoA-mediated contractile responses, which appears to be critical for effective cell steering during metastatic progression . Furthermore, understanding the signaling mechanisms linking LPAR1 to matrix remodeling may reveal potential therapeutic vulnerabilities in metastatic cancer cells.

How can researchers overcome antibody specificity issues when studying LPAR1?

Identifying LPAR1 protein expression in situ and in vivo within tissues has been notably challenging due to biologically low receptor expression levels and variable antibody specificity . Researchers working with sheep LPAR1 should implement the following strategies to address these limitations:

  • Epitope mapping and antibody validation: Carefully select antibodies targeting highly conserved regions between human, mouse, and sheep LPAR1. Rigorous validation using positive and negative controls including LPAR1 knockout or overexpression systems is essential.

  • Multiple antibody approach: Employ several antibodies targeting different epitopes of LPAR1 to confirm expression patterns through consensus findings.

  • Recombinant expression tagging: Generation of epitope-tagged or fluorescent protein-fused LPAR1 constructs (such as LPAR1-EGFP) allows for direct visualization without relying on antibodies for detection.

  • Proximity ligation assays: This technique can enhance detection sensitivity by amplifying signals when two antibodies bind in close proximity, useful for low-abundance receptors like LPAR1.

  • Mass spectrometry-based approaches: For absolute quantification of receptor expression in different tissues, though this requires significant tissue amounts and specialized equipment.

  • Transgenic reporter approaches: While more resource-intensive, generation of sheep LPAR1-EGFP knock-in animals similar to the mouse models provides the most reliable method for visualizing native receptor expression patterns.

The combination of these approaches helps overcome the limitations of any single detection method and provides more reliable information about LPAR1 expression patterns in sheep tissues.

What are the optimal strategies for studying LPAR1 interactions with downstream effectors?

Understanding the interactions between LPAR1 and its downstream signaling partners is essential for elucidating its functional roles across different contexts. For researchers studying sheep LPAR1, several approaches can provide insights into these molecular interactions:

  • Co-immunoprecipitation (Co-IP): For identifying protein-protein interactions between LPAR1 and G-proteins, β-arrestins, or other binding partners. When performing Co-IP with GPCRs like LPAR1, particular attention should be paid to:

    • Membrane solubilization conditions to maintain receptor structure

    • Cross-linking strategies to capture transient interactions

    • Detergent selection to preserve protein-protein interfaces

  • Bioluminescence/Fluorescence Resonance Energy Transfer (BRET/FRET): These approaches enable real-time monitoring of protein interactions in living cells and are particularly useful for capturing dynamic, agonist-dependent interactions.

  • Proximity-based labeling: Techniques like BioID or APEX2 can identify proteins in the vicinity of LPAR1 within the cellular environment, including those with weak or transient interactions.

  • G-protein specific assays: Using G-protein subtype-specific biosensors to determine which G-protein subtypes couple to sheep LPAR1 upon LPA stimulation.

  • Functional confirmation: Complementing interaction studies with functional assays to verify the biological significance of identified interactions. For example, RhoA activity assays can confirm functional coupling to Gα12/13 pathways .

  • Receptor mutational studies: Creating specific mutations in ovine LPAR1 to identify residues critical for interactions with different signaling partners.

These approaches collectively provide a comprehensive view of LPAR1's signaling network in sheep cells, enabling comparative analysis with human and mouse LPAR1 signaling pathways.

What are the considerations for developing functional assays using recombinant sheep LPAR1?

Developing robust functional assays for recombinant sheep LPAR1 requires careful consideration of receptor pharmacology, expression systems, and readout technologies. Researchers should address the following aspects:

  • Ligand considerations:

    • LPA species diversity: Different LPA species (varying in acyl chain length and saturation) may activate LPAR1 with varying potencies. Standardization of ligand preparations is essential.

    • SAR100842 has been shown to be equipotent against various LPA isoforms when studying LPAR1 antagonism , suggesting it may be a valuable tool in sheep LPAR1 functional studies.

  • Expression system selection:

    • For compound screening, stable expression in mammalian cells (HEK293, CHO) typically provides the most physiologically relevant system.

    • Expression levels should be carefully controlled, as over-expression may lead to constitutive activity or altered pharmacology.

  • Functional readouts:

    • Calcium mobilization assays have been successfully used to study LPAR1 activation and can detect functional responses that are fully antagonized by selective inhibitors .

    • Receptor internalization assays using fluorescently-tagged receptors can provide information on receptor activation dynamics.

    • RhoA activation assays are particularly relevant given LPAR1's role in contractility and migration .

    • Transcriptional reporter assays can detect long-term signaling outcomes.

  • Validation approaches:

    • Known LPAR1 antagonists like ki16425 or SAR100842 should be used as positive controls to confirm assay specificity .

    • Comparison with human LPAR1 responses provides important reference data for translational relevance.

    • Dose-response and time-course analyses should be performed to fully characterize the pharmacological properties of sheep LPAR1.

The development of these assays not only facilitates basic research on sheep LPAR1 but also enables translational studies including compound screening for agricultural or veterinary applications.

How can CRISPR-Cas9 technology be applied to study sheep LPAR1 function?

CRISPR-Cas9 gene editing offers powerful approaches for investigating LPAR1 function in sheep cells and potentially in sheep models. Researchers can implement several CRISPR-based strategies:

  • Knockout studies: Complete deletion of LPAR1 in sheep cell lines to establish loss-of-function phenotypes, similar to approaches used in pancreatic cancer cell studies where LPAR1 CRISPR knockout cell lines showed severely reduced chemotaxis .

  • Knock-in approaches: Introduction of reporter tags (such as EGFP) into the endogenous LPAR1 locus, following approaches similar to the LPAR1-EGFP knock-in mouse model . This enables visualization of native receptor expression while maintaining physiological regulation.

  • Domain mutation studies: Introduction of specific mutations to disrupt particular functions (G-protein coupling, β-arrestin binding, etc.) while preserving others, allowing dissection of pathway-specific roles.

  • Regulatory element manipulation: Editing of LPAR1 promoter or enhancer regions to understand transcriptional regulation in different tissue contexts.

  • Base editing applications: For introducing specific amino acid changes with minimal disruption to the genomic locus.

When designing CRISPR experiments for sheep LPAR1, researchers should consider:

  • Target site selection accounting for sheep genome specificity

  • Appropriate delivery methods for sheep cells (electroporation, lipofection, or viral vectors)

  • Comprehensive validation of editing outcomes through sequencing and functional assays

  • Off-target effect analysis specific to the sheep genome

These approaches provide unprecedented specificity in manipulating LPAR1 function and can reveal novel insights into receptor biology in sheep-specific contexts.

What are the emerging techniques for studying LPAR1 in three-dimensional tissue environments?

Traditional two-dimensional cell culture systems inadequately recapitulate the complex environments where LPAR1 functions in vivo. Emerging three-dimensional approaches offer more physiologically relevant contexts for studying sheep LPAR1:

  • Organoid systems: Development of sheep tissue-specific organoids (liver, skin, brain) expressing native LPAR1 enables studies of receptor function in structured multicellular environments.

  • Tissue-on-chip platforms: Microfluidic devices incorporating sheep cells can model complex tissue architectures while permitting controlled manipulation of LPA gradients and real-time imaging of cellular responses.

  • 3D bioprinting: Creation of defined three-dimensional structures incorporating sheep cells expressing LPAR1, particularly valuable for studying processes like angiogenesis where spatial organization is critical.

  • Hydrogel-based 3D culture systems: Using defined extracellular matrix components to create tunable environments for studying how matrix properties influence LPAR1-mediated functions like migration and differentiation.

  • Ex vivo tissue slice cultures: Maintaining the native architecture of sheep tissues while allowing experimental manipulation and imaging of LPAR1-expressing cells within their natural milieu.

These advanced culture systems are particularly relevant for studying LPAR1's roles in processes like fibrosis, where complex cell-cell and cell-matrix interactions significantly influence receptor function. For example, studies of LPAR1 in skin fibrosis demonstrate that results from isolated dermal fibroblasts mirror those obtained in mouse models , suggesting that appropriately designed 3D systems could bridge the gap between traditional cell culture and in vivo studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.