Recombinant Sheep Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MPVLGSQRRLLGSLNCTPPATLPLTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAMSDLLVSVSNVLETAVMLLLEAGVLATRAAVVQQLDNVI DVLICSSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSVLSI TYYNHTVVLLCLVGFFIAMLALMAVLYVHMLARACQHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
This receptor acts as a receptor for MSH (alpha, beta and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through regulation of cAMP signaling in melanocytes.
Gene References Into Functions
  1. MC1R plays a role in controlling wool color in Brazilian Creole sheep. PMID: 22653672
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MC1R in sheep coat coloration?

MC1R, also known as α-melanocyte stimulating hormone receptor (α-MSHR), is a seven-transmembrane G-protein coupled receptor encoded by the extension (E) locus. It plays a significant role in melanogenesis and wool pigmentation, functioning as a master regulator responsible for black coat color in sheep. The receptor primarily works by controlling the biochemical function, availability, and distribution of phaeomelanin and eumelanin pigments, which determine the spectrum of coat colors in sheep. When functionally active, MC1R promotes the production of eumelanin (black/brown pigment), while disruptions in MC1R signaling typically result in the production of phaeomelanin (red/yellow pigment) .

MC1R activation initiates a signaling cascade leading to cAMP production, which is critical for melanogenesis. Studies have demonstrated that MC1R mRNA expression levels are significantly higher in black-headed sheep compared to white sheep, providing direct evidence of its role in color determination. Additionally, research has confirmed that MC1R serves as a potential candidate gene playing a crucial role in wool pigmentation across various sheep breeds worldwide .

How do we classify MC1R variants in sheep, and what is their significance?

MC1R variants in sheep can be classified based on their functional effects on receptor signaling. The most common classification system divides variants into two main categories:

  • High-penetrance (R) variants: These cause significant impairment of receptor signaling for cAMP production. Examples include rs1805007, rs1805008, rs1805009, rs312262906, rs11547464, rs1805006, and rs555179612. These variants typically have strong effects on phenotype .

  • Low-penetrance (r) variants: These show milder effects on receptor function, including rs1805005, rs2228479, and rs885479 .

Variants can also be classified using in silico prediction tools:

  • SIFT (Sorting Intolerant From Tolerant): Evaluates variants based on cross-species conservation

  • PolyPhen: Predicts structural alterations in the protein

Complete loss-of-function (null) variants, such as rs312262906 and rs555179612, represent the most extreme disruptions of MC1R function . The classification of these variants is crucial for understanding the genetic basis of coat color variation and for predicting phenotypic outcomes in breeding programs.

What are the known structural characteristics of sheep MC1R protein?

The sheep MC1R protein consists of 313 amino acid residues organized into a typical G-protein coupled receptor structure with seven transmembrane helices. These transmembrane domains are essential for receptor stability and function, allowing the protein to properly fold and anchor in the cell membrane. The receptor contains both extracellular and intracellular domains that interact with ligands and signaling molecules, respectively .

Critical regions of the MC1R protein include:

  • The ligand-binding pocket formed by the transmembrane helices

  • The G-protein coupling region in the intracellular domain

  • Several conserved motifs essential for receptor activation and signal transduction

Structural disruptions, particularly those affecting the transmembrane helices, can result in complete loss of receptor function. For example, the Mc1r Δ500fs deletion identified in pigeons (which has structural homology to sheep MC1R) removes over half of the protein's codons, including multiple transmembrane helices, resulting in the complete loss of MC1R function .

Which specific MC1R variants are associated with coat color phenotypes in sheep?

Genome-wide association studies have identified several significant MC1R variants associated with coat color variation in sheep. Two particularly significant single nucleotide polymorphisms (SNPs) have been located on chromosome 14:

  • rs409651063 (Position: 14.232 Mb): This is a missense variant (g.14231948 G>A) causing an amino acid change (Asp105Asn) in the coding region. The SIFT prediction value for this variant is 0.01, indicating a deleterious effect on protein function .

  • rs408511664 (Position: 14.228 Mb): This is an upstream variant (g.14228343G>A) that likely affects gene expression rather than protein structure .

These variants were identified with extremely high statistical significance (-log10(P) values of 2.47E-14 and 1.00E-13, respectively), demonstrating their strong association with coat color phenotypes. Additional studies have identified regulatory region variants that affect MC1R expression levels. For instance, a 26-nucleotide deletion/insertion mutation in the 5'-UTR region was found in breeds such as Romanov, Zel, and Iran-Black, along with a nucleotide substitution of -206G>A .

How do MC1R variants correlate with geographic distribution and evolutionary adaptation in sheep?

MC1R variants often exhibit geographic distribution patterns that reflect evolutionary adaptation and selective breeding. In thinhorn sheep (Ovis dalli), researchers have identified a 1200 km color cline from light to dark sheep occurring across three genetically distinct polymorphic populations. A single nucleotide polymorphism at base pair position 921 in the MC1R gene coincides with this geographic cline, suggesting potential adaptation to local environments .

The distribution of MC1R variants also reflects human selection pressures in domesticated sheep breeds. Different cultural preferences for coat colors have led to the selection and maintenance of specific MC1R variants in different regions. This artificial selection has accelerated phenotypic differentiation between breeds and created distinct genetic signatures in regional sheep populations.

What are the molecular mechanisms by which MC1R variants affect pigmentation?

The molecular mechanisms through which MC1R variants affect pigmentation involve several pathways:

  • Alteration of receptor binding affinity: Missense mutations in the ligand-binding domain can affect the receptor's ability to bind α-MSH (melanocyte-stimulating hormone), its natural ligand .

  • Disruption of signal transduction: Variants can impair the receptor's ability to activate G-proteins and stimulate cAMP production, which is essential for eumelanin synthesis .

  • Regulatory region effects: Polymorphisms in the 5'-UTR region affect transcription factor binding sites. For example, identified polymorphisms result in the loss and alteration of motifs and transcription factor binding sites such as MOK2 and Gamma_IRE_CS, influencing gene expression mechanisms .

  • Complete loss of function: Frameshift mutations like the Mc1r Δ500fs observed in pigeons (homologous to sheep MC1R) can eliminate protein function entirely, resulting in pheomelanic phenotypes .

These mechanisms explain the phenotypic spectrum observed in sheep, from dominant black coloration (functional MC1R) to various degrees of red/brown/white coloration (impaired MC1R function).

What are the recommended methods for genotyping MC1R variants in sheep?

Several effective methods have been established for genotyping MC1R variants in sheep:

  • PCR amplification and Sanger sequencing: This is the gold standard approach for identifying known and novel variants. Primers should be designed to flank the entire coding region of the MC1R gene as well as regulatory regions . For example, researchers investigating the 5'-flanking region of the MC1R gene used this method after DNA isolation with a modified salting-out technique .

  • PCR-RFLP (Restriction Fragment Length Polymorphism): This method can be used to detect specific known variants that create or destroy restriction enzyme recognition sites.

  • Custom SNP genotyping arrays: For high-throughput analysis, custom arrays containing known MC1R variants can be used. The ovine 600K SNP BeadChip has been successfully employed in genome-wide association studies of coat color .

  • Real-time PCR with allele-specific probes: This approach allows for rapid genotyping of specific variants in large numbers of samples.

When screening for large structural variants such as deletions, PCR using primers that flank the suspected region followed by gel electrophoresis can reveal size differences. This approach successfully identified a 500 bp deletion in the pigeon MC1R gene , and similar methods could be applied to detect potential structural variants in sheep.

How can MC1R expression levels be accurately quantified in sheep skin tissues?

Several complementary methods can be used to accurately quantify MC1R expression levels in sheep skin tissues:

  • RT-qPCR (Reverse Transcription Quantitative PCR): This technique provides sensitive quantification of MC1R mRNA levels. Studies have shown significantly higher MC1R mRNA levels in the skin samples of black-headed sheep compared to white sheep, and very significantly higher levels in GA versus GG genotype individuals .

  • Quantitative Immunofluorescence: This approach allows for spatial visualization and quantification of MC1R protein expression in tissue sections. The method has been successfully used to measure MC1R expression in melanoma progression and could be adapted for sheep skin samples .

  • Immunohistochemistry (IHC): Though less quantitative than immunofluorescence, IHC provides valuable information about the cellular and tissue distribution of MC1R protein.

  • Western Blotting: This technique can be used to quantify total MC1R protein levels in tissue lysates, though it lacks the spatial resolution of microscopy-based methods.

For optimal results, researchers should consider using multiple methods in parallel, as each provides complementary information. Additionally, proper normalization with housekeeping genes (for RT-qPCR) or proteins (for Western blotting) is essential for accurate quantification across different samples.

What are the challenges in producing functional recombinant sheep MC1R for in vitro studies?

Producing functional recombinant sheep MC1R presents several specific challenges:

  • Protein folding and membrane integration: As a seven-transmembrane G-protein coupled receptor, MC1R requires proper folding and membrane integration to function correctly. Expression systems must provide appropriate cellular machinery for post-translational modifications and membrane insertion.

  • Maintaining functional conformation: The three-dimensional structure of MC1R is critical for its function. Expression conditions must be optimized to prevent protein aggregation or misfolding.

  • Purification difficulties: Membrane proteins like MC1R are notoriously difficult to purify in their native conformation. Detergent selection is critical, as it must solubilize the receptor while maintaining its functional structure.

  • Functional assay development: Verifying that recombinant MC1R retains its native function requires development of appropriate binding and signaling assays. These typically involve measuring cAMP production in response to α-MSH binding.

  • Species-specific interactions: Recombinant sheep MC1R may interact differently with ligands and signaling proteins from other species, necessitating the co-expression of appropriate sheep G-proteins for functional studies.

To address these challenges, researchers typically employ mammalian expression systems (rather than bacterial systems) that provide appropriate cellular machinery for GPCR expression. HEK293 or CHO cells are commonly used, often with inducible expression systems to control protein production levels and prevent toxicity.

How can CRISPR-Cas9 gene editing be used to study MC1R function in sheep?

CRISPR-Cas9 gene editing presents powerful opportunities for studying MC1R function in sheep through several strategic approaches:

  • Knockout studies: Complete MC1R gene knockout can confirm its necessity for normal pigmentation. This approach would involve designing guide RNAs targeting critical exons of the MC1R gene, followed by introduction into sheep embryos or derived cell lines.

  • Precise mutation introduction: CRISPR can be used to introduce specific naturally occurring MC1R variants (like rs409651063 or rs408511664) into cultured sheep melanocytes or embryos to directly observe their phenotypic effects . This requires precise homology-directed repair (HDR) with carefully designed donor templates.

  • Regulatory element modification: The 5'-UTR region of MC1R contains important motifs and transcription factor binding sites (like MOK2 and Gamma_IRE_CS) . CRISPR can be used to specifically modify these elements to study their impact on gene expression.

  • Fluorescent tagging: CRISPR-mediated insertion of fluorescent protein tags can enable live-cell imaging of MC1R trafficking and localization within melanocytes.

When designing CRISPR experiments for sheep MC1R, researchers should carefully consider off-target effects, mosaicism in edited animals, and appropriate controls. Verification of edits should employ sequencing, functional assays (cAMP signaling), and phenotypic assessment. This technology offers unprecedented precision in understanding the structure-function relationships of MC1R variants in sheep.

What insights from sheep MC1R research can be applied to human melanoma studies?

Sheep MC1R research provides several valuable insights applicable to human melanoma studies:

  • Signaling pathway conservation: The fundamental signaling mechanisms of MC1R are conserved between sheep and humans. Understanding how specific mutations affect receptor function in sheep can provide insights into human MC1R variants .

  • DNA repair mechanisms: MC1R plays a critical role in DNA repair mechanisms beyond pigmentation. Studies have shown that upregulation of DNA repair pathways in melanoma has been linked with metastasis and poor patient prognosis. This may explain the observed association between high MC1R expression and worse survival in primary and metastatic melanoma lesions .

  • Targeted therapeutics development: The unique expression pattern of MC1R on melanoma cells makes it a promising target for therapeutic development. Approaches being investigated include MC1R-targeting peptides for imaging (like VMT01) and potential therapeutic applications such as antibody-drug conjugates (ADCs) or CAR-T therapies .

  • Expression patterns during disease progression: Quantitative studies of MC1R have demonstrated a stepwise elevation of expression during melanoma progression from benign nevi to primary melanoma to metastatic disease. This pattern mirrors observations in certain sheep breeds where MC1R expression correlates with coat color intensity .

These translational insights highlight the value of comparative studies between species and demonstrate how fundamental research on sheep MC1R can contribute to biomedical applications in human disease.

How do environmental factors interact with MC1R genotypes to influence phenotypic expression in sheep?

The interaction between environmental factors and MC1R genotypes in sheep represents a complex area of gene-environment interaction research:

  • Ultraviolet radiation exposure: UV radiation is known to influence melanin production. Sheep with different MC1R genotypes may show varying responses to seasonal or altitude-related changes in UV exposure, which could explain some of the geographic clines observed in sheep populations .

  • Temperature adaptation: Coat color affects heat absorption and dissipation. Research indicates that coat color is of significant interest to researchers due to its effect on a sheep's ability to adapt to environmental heat stress . Different MC1R variants may provide selective advantages in different climate zones.

  • Diet and nutrition: Dietary factors can influence melanin synthesis through metabolic pathways that intersect with MC1R signaling. Nutritional status may modulate the phenotypic expression of specific MC1R variants.

  • Hormonal influences: Seasonal hormonal changes may interact with MC1R signaling, potentially explaining some temporal variations in coat coloration observed in certain sheep breeds.

These interactions help explain why MC1R variants sometimes show geographic correlation at the population level without direct relationships between individual melanism and genotype . Future research employing controlled environmental conditions with known MC1R genotypes would help elucidate these complex interactions and their evolutionary significance.

How can researchers integrate MC1R data with other coat color genes to predict sheep phenotypes?

Predicting sheep coat color phenotypes requires sophisticated data integration approaches that account for multiple interacting genes:

  • Multi-locus genotyping: Beyond MC1R, researchers should simultaneously analyze other key coat color genes such as ASIP (Agouti Signaling Protein), TYRP1 (Tyrosinase-related protein 1), and TYR (Tyrosinase). This comprehensive approach helps explain phenotypic variations not accounted for by MC1R variants alone.

  • Statistical modeling: Predictive models should incorporate known epistatic interactions between genes. For example, ASIP variants can mask the effects of MC1R variants through competitive antagonism of the receptor.

  • Bayesian networks: These probabilistic models can integrate genotype data from multiple loci along with environmental factors to predict phenotypic outcomes with associated confidence levels.

  • Machine learning approaches: As more genotype-phenotype data becomes available, supervised learning algorithms can be trained to recognize complex patterns and improve prediction accuracy.

An effective predictive framework should account for:

  • Dominance relationships between alleles

  • Epistatic interactions between genes

  • Regulatory region variations affecting gene expression

  • Environmental modulators of gene expression

This integrated approach would help explain situations where MC1R variants coincide with geographic clines at the population level but don't show direct relationships with individual phenotypes .

What contradictory findings exist in MC1R research, and how might they be resolved?

Several contradictory findings in MC1R research require careful consideration:

  • Genotype-phenotype discrepancies: In thinhorn sheep, researchers found a SNP in MC1R that coincided with a geographic color cline, but at the individual level, there was no relationship between individual melanism and genotype . This contradiction suggests that:

    • Other genes may modify MC1R effects

    • Complex epistatic interactions may exist

    • Environmental factors may play a larger role than previously thought

  • Functional effects of variants: Studies sometimes disagree on the extent of functional effects for specific variants. For example, while there is consensus that certain variants (R) confer considerable impairment of cAMP signaling, the exact magnitude of these effects varies between studies .

  • Regulatory versus coding variants: Some studies emphasize the importance of coding variants , while others highlight regulatory region polymorphisms . Both likely contribute to phenotypic variation, but their relative importance may differ between breeds.

To resolve these contradictions, researchers should:

  • Conduct larger studies with more diverse sheep breeds

  • Implement standardized phenotyping protocols

  • Employ multiple methodological approaches in parallel

  • Consider epistatic interactions and pleiotropy

  • Develop more sophisticated statistical models that account for complex inheritance patterns

What are the most promising future directions for sheep MC1R research?

Several promising future directions for sheep MC1R research could yield significant scientific advances:

  • Functional genomics approaches: CRISPR-Cas9 gene editing combined with single-cell transcriptomics could provide unprecedented insights into how specific MC1R variants affect melanocyte development and function at the cellular level.

  • Systems biology integration: Developing comprehensive models that integrate MC1R signaling with other melanogenesis pathways would help explain complex phenotypes and gene-environment interactions.

  • Comparative genomics: Expanded analysis across wild and domestic sheep breeds globally would provide insights into evolutionary adaptation and the genetic architecture of coat color.

  • Epigenetic regulation: Investigating how DNA methylation and histone modifications regulate MC1R expression could explain some phenotypic variations not accounted for by genetic sequence alone.

  • Translational applications: Further exploration of the connections between sheep MC1R function and human diseases like melanoma could yield valuable biomedical insights .

  • Climate adaptation: As global climate changes, understanding how MC1R variants contribute to heat tolerance becomes increasingly important for sheep breeding programs .

  • Novel imaging technologies: Development of non-invasive imaging techniques to visualize MC1R expression and melanin distribution in live animals would enable longitudinal studies of coat color development.

These future directions would not only advance our understanding of the basic biology of pigmentation but also contribute to practical applications in agriculture, biomedicine, and evolutionary biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.