Recombinant Sheep Melatonin-related receptor (GPR50)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sheep Melatonin-Related Receptor (GPR50)

The recombinant sheep melatonin-related receptor (GPR50) is a laboratory-engineered form of the G protein-coupled receptor 50 (GPR50) derived from Ovis aries (sheep). As an orphan receptor within the melatonin receptor subfamily, GPR50 shares structural homology with melatonin receptors MT₁ and MT₂ but lacks melatonin-binding capability . Recombinant versions, such as the His-tagged full-length sheep GPR50 protein (Catalog #: RFL23569OF), are produced in E. coli systems for functional and structural studies .

Interaction with Melatonin Receptors

GPR50 inhibits melatonin receptor 1A (MT₁) signaling through heterodimerization, blocking agonist binding and G-protein coupling . This regulatory mechanism is conserved across species, including sheep .

Metabolic and Neuroendocrine Roles

  • Energy homeostasis: GPR50 is expressed in hypothalamic regions (e.g., dorsomedial nucleus) linked to metabolic regulation .

  • Photoperiod adaptation: In seasonal mammals like Siberian hamsters, GPR50 expression correlates with body weight changes under varying light conditions .

Evolutionary Insights

GPR50 is the mammalian ortholog of the non-mammalian Mel1c receptor, which binds melatonin in fish and birds. Key evolutionary changes in GPR50 include:

  • Loss of melatonin-binding residues (e.g., Thr substitution in the second extracellular loop) .

  • Acquisition of a long C-terminal tail, absent in non-mammalian Mel1c .

Research Applications

Recombinant sheep GPR50 is utilized in:

  1. Receptor interaction studies: Investigating heterodimerization with MT₁/MT₂ .

  2. Antibody development: Validating tools for neuroanatomical distribution mapping (e.g., in sheep brain) .

  3. Metabolic pathway analysis: Exploring roles in energy balance and thyroid hormone signaling .

Table 2: Pathways involving GPR50

PathwayAssociated Proteins
GPCRs, Class A Rhodopsin-likeCMKLR1, APLNR, CCR9, OPN1MW2
Neuroactive ligand-receptor interactionFSHR, GRM5, MC1R, TAAR14J

Key Research Findings

  • Heterodimerization: Co-expression of GPR50 with MT₁ reduces melatonin-induced signaling by 45–50% in cellular models .

  • Brain distribution: Sheep GPR50 is abundant in the hypothalamus, pituitary pars tuberalis, and median eminence .

  • Disease associations: Human GPR50 polymorphisms are linked to bipolar disorder and metabolic dysregulation , highlighting its translational relevance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
GPR50; Melatonin-related receptor; G protein-coupled receptor 50; H9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-575
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MGRTLAVPTPYGCIGCKLPQPDYPPALIVFMFCAMVITIVVDLIGNSMVILAVSKNKKLR NSGNVFVVSLSVADMLVAIYPYPLMLHAMAIGGWDLSKLQCQMVGFITGLSVVGSIFNIM AIAINRYCYICHSLQYERIFSVRNTCIYLAVTWIMTVLAVLPNMYIGTIEYDPRTYTCIF NYVNNPAFAVTIVCIHFVLPLLIVGFCYVKIWTKVLAARDPAGQNPDNQLAEVRNFLTMF VIFLLFAVCWCPINALTVLVAVNPKEMAGKIPNWVYLAAYFIAYFNSCLNAVIYGVLNEN FRREYWTIFHAMRHPVLFLSGLLTDVREMQEAQAHTHARARARTQAHEQDHAHACPAVEE IPMSVRNVPLPGHGAAGQPECVSGHPKPASGHSRSVSARRKSASAHPKSASGQSKSATVY PKPTSVHFKPSSVYFKADSVYFKPSSSHPKPITGPSKTAISPATSFPKPTTGYTQHATIH SEPTTLDYLEPITTSHSKPVIASHSELAASCHLECNIFDLSDPTSSPASDSSNSAASLLD PTAAAAATVNPTVVTTDYHEIVLIDVDADSDEMAV
Uniprot No.

Target Background

Function
This protein does not bind melatonin.
Gene References Into Functions
  1. An enlarged distribution of GPR50 protein in the brain. PMID: 22512326
Database Links

KEGG: oas:443023

UniGene: Oar.606

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR50 and how does it relate to the melatonin receptor family?

GPR50 is one of three subtypes of the melatonin receptor subfamily, alongside MT₁ (MTNR1A) and MT₂ (MTNR1B) receptors. Despite sharing 45% homology with melatonin receptors and high sequence identity with the melatonin receptor family, GPR50 does not bind melatonin or any other known ligand, classifying it as an orphan G protein-coupled receptor . The receptor belongs to the G-protein coupled receptor 1 family and can inhibit melatonin receptor 1A function through heterodimerization, suggesting a potential regulatory role in melatonin signaling pathways .

What are the key structural differences between sheep GPR50 and GPR50 from other species?

The sheep GPR50 shares substantial homology with GPR50 from other mammalian species, but species-specific variations exist particularly in the C-terminal tail region. When working with recombinant sheep GPR50, researchers should note that antibodies generated against the ovine form have been successfully used to analyze GPR50 distribution in sheep, rat, and mouse brains, indicating conserved epitopes across species . Specific sequence differences can be analyzed through alignment studies, with particular attention to functional domains that may influence binding properties and downstream signaling pathways.

How can I verify the expression and functionality of recombinant sheep GPR50 in experimental systems?

Verification of recombinant sheep GPR50 expression can be accomplished through multiple complementary approaches:

  • Western blot analysis using validated anti-GPR50 antibodies (various commercially available options target different epitopes including cytoplasmic domain and C-terminus)

  • Immunocytochemistry or immunofluorescence to visualize cellular localization

  • Functional assays examining:

    • Heterodimerization with MT₁ receptors

    • Downstream signaling effects

    • Changes in cAMP levels or calcium mobilization

For experimental validation, include positive controls using tissues known to express GPR50 (hypothalamic regions, particularly the dorsomedial nucleus) and negative controls using tissues from GPR50 knockout models when available .

What are the most effective methods for detecting GPR50 protein expression in tissue samples?

The detection of GPR50 protein expression in tissue samples can be optimally achieved through a multi-methodological approach:

Immunohistochemistry/Immunofluorescence:

  • Use immunoaffinity-purified antibodies specifically targeting the cytoplasmic domain or C-terminus of GPR50

  • Implement antigen retrieval techniques for paraffin-embedded sections

  • Validate specificity using GPR50 knockout tissue as negative controls

  • Consider double-labeling with markers for specific cell types to determine co-localization patterns

In situ hybridization:

  • Design riboprobes targeting the GPR50 mRNA sequence (nucleotides 1083-1422 have been successfully used)

  • Use radioactive ([³³P]UTP) or non-radioactive (digoxigenin) labeling methods

  • Quantify hybridization signals through densitometric analysis of autoradiographic films

X-gal staining in transgenic models:

  • In GPR50 knockout mice with LacZ insertion, X-gal staining provides a sensitive method to visualize GPR50 promoter activity

  • Combine with immunohistochemistry for cell-type markers (e.g., GLUT1, GFAP, nestin) to identify specific GPR50-expressing cell populations

These approaches collectively provide comprehensive information about GPR50 expression patterns at both mRNA and protein levels.

What experimental design considerations are important when working with recombinant sheep GPR50 protein?

When designing experiments with recombinant sheep GPR50 protein, researchers should consider:

Protein Purity and Quality:

  • Verify protein purity (≥85% by SDS-PAGE is standard for commercial preparations)

  • Assess protein folding and integrity through circular dichroism or limited proteolysis

Expression Systems:

  • E. coli systems: suitable for producing partial domains for structural studies

  • Mammalian cell systems: preferred for full-length receptor expression with proper post-translational modifications

  • Baculovirus systems: suitable for larger-scale production with eukaryotic modifications

Functional Assessment Protocol:

  • Design positive control experiments using known GPR50 interactions (e.g., heterodimerization with MT₁)

  • Include appropriate negative controls in all experiments

  • Consider the use of tag-free protein vs. His-tagged or other fusion proteins based on experimental requirements

Storage and Stability:

  • Establish optimal buffer conditions and storage protocols to maintain protein functionality

  • Validate protein activity after freeze-thaw cycles if applicable

How can I optimize antibody-based detection of GPR50 in immunohistochemical studies?

Optimizing antibody-based detection of GPR50 requires several critical steps:

  • Antibody Selection:

    • Choose antibodies validated specifically for sheep GPR50 or with demonstrated cross-reactivity

    • Consider antibodies targeting different epitopes (cytoplasmic domain vs. C-terminus) based on experimental needs

    • Verify specificity using blocking peptides and tissues from GPR50 knockout animals

  • Tissue Preparation:

    • Optimize fixation protocols (2% paraformaldehyde in 0.1M phosphate buffer has been effective)

    • For brain tissue, post-fixation for 5 hours at 4°C followed by cryoprotection in 30% sucrose improves section quality

    • Section thickness of 30μm is recommended for brain tissue studies

  • Detection Protocol:

    • Implement appropriate blocking with 5% normal serum

    • Optimize primary antibody concentration and incubation conditions (overnight at 4°C is standard)

    • Consider signal amplification techniques such as avidin-biotin complex method for low abundance targets

    • Include parallel validation using in situ hybridization or X-gal staining in knockout models

  • Data Analysis:

    • Document complete methodological details for reproducibility

    • Include quantification methods such as cell counting or intensity measurements

    • Present representative images alongside quantitative data

Following these optimization steps significantly improves the reliability and sensitivity of GPR50 detection in tissue samples.

What is the neuroanatomical distribution of GPR50 receptor in the mammalian brain?

GPR50-positive cells exhibit a specific and conserved distribution pattern across mammalian species, with both similarities and species-specific differences:

Conserved Distribution Across Species (Sheep, Rat, Mouse):

  • Hypothalamus, particularly the dorsomedial nucleus

  • Periventricular nucleus

  • Median eminence

  • Pars tuberalis of the pituitary

Broader Distribution in Rodents:

  • Medial preoptic area (MPA)

  • Lateral septum

  • Lateral hypothalamic area

  • Bed nucleus of the stria terminalis

  • Vascular organ of the laminae terminalis

  • Multiple amygdala regions, including medial nuclei

Species-Specific Locations:

  • Rat: CA1 pyramidal cell layer of the dorsal hippocampus

  • Mouse: Subfornical organ with moderate to high expression

  • Sheep: More restricted distribution compared to rodents

This neuroanatomical distribution pattern suggests potential roles in neuroendocrine regulation, energy metabolism, and emotional processing based on the functions associated with these brain regions.

How does GPR50 expression change in response to physiological challenges?

GPR50 expression demonstrates remarkable plasticity in response to physiological challenges, particularly those related to energy homeostasis:

Energy Status Regulation:

  • Fasting: Significantly reduces GPR50 expression in hypothalamic regions

  • High-energy diet (HED): After 5 weeks, causes substantial downregulation of GPR50 expression

  • These bidirectional changes suggest GPR50 may function as an energy sensor responding to both positive and negative energy balance states

Mechanisms of Expression Regulation:

  • Transcriptional control appears to be a primary regulatory mechanism

  • The exact signaling pathways mediating these expression changes remain to be fully elucidated

  • Potential involvement of hypothalamic nutrient-sensing pathways

This dynamic regulation of GPR50 expression provides strong evidence for its involvement in metabolic adaptation responses and energy homeostasis maintenance.

What functional interactions have been identified between GPR50 and other signaling systems?

Despite being an orphan receptor without identified endogenous ligands, GPR50 participates in several significant functional interactions:

Melatonin Receptor Interactions:

  • Forms heterodimers with MT₁ (MTNR1A) receptors

  • Inhibits MT₁ receptor function through this heterodimerization

  • May serve as an endogenous regulator of melatonin signaling

Metabolic Pathway Interactions:

  • Influences energy expenditure pathways as evidenced by metabolic phenotypes in knockout models

  • May interact with hypothalamic feeding circuits

  • Potential crossover with leptin and/or insulin signaling based on its role in diet-induced obesity resistance

Relevance to Neuropsychiatric Conditions:

  • Polymorphic variants associate with bipolar affective disorder in women

  • Suggests potential interactions with neurotransmitter systems involved in mood regulation

These interactions position GPR50 at the intersection of circadian, metabolic, and affective regulatory systems, highlighting its potential importance as an integrative signaling node.

What are the key metabolic phenotypes observed in GPR50 knockout mice?

GPR50 knockout mice exhibit a distinctive metabolic phenotype characterized by several robust and consistent alterations:

Body Weight and Composition:

  • Lower body weight than wild-type littermates, becoming apparent by 10 weeks of age

  • Partial resistance to diet-induced obesity when fed high-energy diets

  • Reduced body fat content despite higher food intake per unit body weight

Energy Balance Parameters:

  • Significantly increased food consumption (hyperphagia) when normalized to body weight

  • Elevated basal metabolic rate as measured by:

    • Increased O₂ consumption

    • Enhanced CO₂ production

    • Altered respiratory quotient

Physical Activity:

  • Significantly increased wheel-running activity

  • Elevated activity levels in both nocturnal and diurnal phases

  • No alteration of circadian period despite activity changes

Metabolic Efficiency:

  • Improved metabolic efficiency suggested by resistance to weight gain despite hyperphagia

  • Potential uncoupling of energy intake and storage mechanisms

This metabolic profile strongly implicates GPR50 as a significant regulator of energy metabolism and suggests potential therapeutic relevance for metabolic disorders.

How can I effectively generate and validate a GPR50 knockout or knockdown model?

Effective generation and validation of GPR50 knockout or knockdown models requires systematic approach:

Knockout Generation Strategies:

  • CRISPR/Cas9 gene editing targeting exons encoding critical functional domains

  • Homologous recombination with reporter gene insertion (e.g., LacZ) to allow visualization of endogenous expression patterns

  • Conditional knockout approaches using Cre-loxP system for tissue-specific deletion

Knockdown Approaches:

  • shRNA or siRNA targeting GPR50 mRNA

  • Antisense oligonucleotides for transient suppression

  • Viral vector delivery systems for region-specific knockdown in the brain

Validation Requirements:

  • Genotyping protocols to confirm genomic alterations

  • RT-PCR and Western blotting to verify absence of mRNA and protein expression

  • Immunohistochemistry in tissues known to express GPR50 (hypothalamus, pars tuberalis)

  • Functional validation through assessment of established phenotypes:

    • Body weight monitoring

    • Food intake measurement

    • Metabolic rate assessment

    • Activity level evaluation

Experimental Controls:

  • Maintain consistent genetic background by using heterozygote breeding schemes

  • Include littermate wild-type controls in all experiments

  • Consider age, sex, and housing conditions as critical variables

This comprehensive approach ensures the development of reliable models for investigating GPR50 function.

What experimental approaches can delineate the mechanisms underlying the metabolic phenotype in GPR50 knockout mice?

Delineating mechanisms underlying the metabolic phenotype in GPR50 knockout mice requires a multi-faceted experimental approach:

Hypothalamic Function Assessment:

  • Electrophysiological recording of neurons in metabolic control centers (dorsomedial hypothalamus)

  • Calcium imaging to assess neuronal activity in response to metabolic challenges

  • Microdialysis to measure neurotransmitter release in feeding circuits

Molecular Pathway Analysis:

  • Transcriptomic profiling (RNA-seq) of hypothalamic regions

  • Proteomic analysis of signaling pathway components

  • Phosphoproteomic assessment to identify altered activation states of metabolic regulators

Energy Expenditure Mechanisms:

  • Indirect calorimetry under various conditions (fasting, feeding, temperature challenges)

  • Assessment of brown adipose tissue thermogenic capacity

  • Analysis of skeletal muscle metabolic efficiency

Tissue-Specific Rescue Experiments:

  • Region-specific re-expression of GPR50 in knockout background

  • Assessment of which phenotypic aspects are rescued by targeted re-expression

  • Use of constitutively active or dominant negative GPR50 mutants

Metabolic Challenge Paradigms:

  • Cold exposure tolerance tests

  • Glucose and insulin tolerance tests

  • Leptin sensitivity assessment

This comprehensive approach enables researchers to connect GPR50 absence with specific molecular and physiological mechanisms driving the observed metabolic phenotype.

What strategies can be employed to identify potential endogenous ligands for the orphan GPR50 receptor?

Identifying endogenous ligands for orphan GPR50 receptor requires innovative approaches:

Unbiased Screening Methods:

  • Reverse pharmacology using cell-based assays with functional readouts

  • Tissue extract fractionation followed by activity testing

  • Mass spectrometry-based metabolomics to identify candidate molecules

  • In silico molecular docking based on receptor homology models

Structure-Function Approaches:

  • Receptor chimera studies with related melatonin receptors

  • Mutagenesis of key binding pocket residues

  • Photoaffinity labeling with promiscuous ligand derivatives

  • Analysis of constitutive activity patterns

Targeted Candidate Testing:

  • Screen melatonin-related compounds despite lack of melatonin binding

  • Test metabolic intermediates based on phenotypic evidence

  • Examine lipid mediators and fatty acids as potential ligands

  • Investigate peptide libraries including hypothalamic neuropeptides

Differential Screening in Physiological States:

  • Compare biological samples from fasted versus fed states

  • Analyze cerebrospinal fluid composition in conditions of altered GPR50 expression

  • Examine samples from disease models with suspected GPR50 involvement

These complementary approaches maximize the chances of identifying the elusive endogenous ligand(s) for GPR50, potentially revealing new signaling pathways.

How might structural analysis of recombinant sheep GPR50 contribute to understanding its function?

Structural analysis of recombinant sheep GPR50 provides critical insights into function through multiple approaches:

Comparative Structural Biology:

  • Homology modeling based on crystal structures of related GPCRs

  • Analysis of key differences in binding pocket architecture between GPR50 and melatonin receptors

  • Identification of structural determinants preventing melatonin binding

Experimental Structure Determination:

  • X-ray crystallography of purified recombinant GPR50 (challenging but potentially achievable with stabilizing mutations)

  • Cryo-electron microscopy of GPR50 in nanodiscs or other membrane mimetics

  • NMR analysis of specific domains (e.g., C-terminal tail implicated in protein interactions)

Dynamic Structural Properties:

  • Molecular dynamics simulations to predict conformational changes

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • FRET-based sensors to monitor conformational changes in living cells

Structure-Guided Investigation:

  • Design of structure-based mutants to test functional hypotheses

  • Identification of potential allosteric binding sites

  • Rational design of synthetic ligands based on structural features

Heterodimerization Interface Mapping:

  • Structural characterization of GPR50-MT₁ heterodimer interfaces

  • Identification of key residues mediating functional inhibition

  • Development of interface-targeting peptides or small molecules

These structural approaches provide a foundation for understanding GPR50's unique properties and developing tools to modulate its function.

What is the potential significance of GPR50 in neuropsychiatric disorders and how can this be investigated?

The association of GPR50 polymorphisms with bipolar affective disorder in women suggests significant neuropsychiatric relevance that can be investigated through:

Genetic and Epigenetic Approaches:

  • Case-control studies examining GPR50 variants across psychiatric conditions

  • Epigenetic profiling of GPR50 promoter regions in patient samples

  • Functional characterization of disease-associated polymorphisms

Molecular Mechanisms in Neuronal Function:

  • Electrophysiological assessment of neuronal excitability in GPR50-expressing regions

  • Analysis of synaptic plasticity in amygdala and hippocampal regions expressing GPR50

  • Investigation of potential impacts on neurotransmitter systems (serotonin, dopamine)

Animal Models of Psychiatric Relevance:

  • Behavioral phenotyping of GPR50 knockout mice in:

    • Anxiety tests (elevated plus maze, open field)

    • Depression paradigms (forced swim, tail suspension)

    • Cognitive tests (working memory, fear conditioning)

  • Sex-specific analysis given the female-specific association with bipolar disorder

Pharmacological Interventions:

  • Response to psychiatric medications in GPR50 knockout models

  • Potential of GPR50-targeting compounds for mood stabilization

  • Interaction with established therapeutic targets in mood disorders

Translational Biomarker Development:

  • Correlation of GPR50 expression levels with symptom severity

  • Development of peripheral biomarkers reflecting central GPR50 status

  • Longitudinal studies examining GPR50 in illness progression

This comprehensive research program would significantly advance understanding of GPR50's role in neuropsychiatric conditions and potentially identify novel therapeutic approaches.

How does GPR50 function integrate with circadian rhythm regulation despite not binding melatonin?

Although GPR50 does not bind melatonin, several lines of evidence suggest its involvement in circadian system regulation:

Anatomical Connections:

  • Expression in the pars tuberalis, a key melatonin target tissue involved in seasonal rhythms

  • Presence in hypothalamic nuclei associated with circadian control

  • Distribution in brain regions receiving input from the suprachiasmatic nucleus

Molecular Interactions:

  • Heterodimerization with MT₁ receptors provides a mechanism for indirect influence on melatonin signaling

  • This interaction potentially creates a regulatory feedback mechanism within the melatonergic system

  • May function as an endogenous brake on melatonin sensitivity in specific brain regions

Functional Evidence:

Future research should explore whether GPR50 expression itself follows circadian patterns and how environmental factors like photoperiod affect its expression and function in seasonal mammals like sheep.

What methodological approaches can resolve contradictory findings in GPR50 research?

Resolving contradictory findings in GPR50 research requires systematic methodological approaches:

Standardization of Experimental Models:

  • Establish consistent genetic backgrounds for knockout models

  • Standardize age, sex, and housing conditions across studies

  • Develop agreed-upon protocols for phenotypic assessments

Comprehensive Replication Studies:

  • Direct replication attempts with sufficient statistical power

  • Multi-laboratory collaborative studies to address lab-specific effects

  • Publication of negative results to reduce publication bias

Resolution of Species Differences:

  • Comparative studies across multiple species (sheep, mouse, rat, human)

  • Careful documentation of species-specific variants and their functional consequences

  • Development of humanized mouse models expressing human GPR50 variants

Technical Considerations:

  • Validation of antibody specificity using multiple approaches

  • Side-by-side comparison of different methodologies

  • Detailed documentation of all experimental parameters

Integration of Data Through Meta-Analysis:

  • Systematic review of existing literature

  • Formal meta-analysis of quantitative findings where possible

  • Identification of moderating variables explaining contradictory results

This methodical approach can help resolve apparent contradictions and establish a more coherent understanding of GPR50 biology.

How can advanced transgenic models contribute to understanding the tissue-specific functions of GPR50?

Advanced transgenic approaches offer powerful tools for dissecting tissue-specific GPR50 functions:

Conditional and Inducible Knockout Strategies:

  • Cre-loxP systems targeting specific brain regions (hypothalamus, amygdala)

  • Tamoxifen-inducible deletions allowing temporal control of GPR50 expression

  • Cell type-specific promoters (neuronal, glial, tanycyte) driving Cre expression

Reporter Systems for Detailed Expression Mapping:

  • Knockin of fluorescent proteins under endogenous GPR50 promoter control

  • Dual-reporter systems to track both GPR50 expression and activation states

  • Single-cell resolution mapping using tissue clearing techniques

Rescue Experiments with Wild-Type and Mutant Forms:

  • Region-specific re-expression in knockout background

  • Introduction of disease-associated variants to assess functional consequences

  • Structure-function analysis through domain-specific mutations

Intersectional Genetic Approaches:

  • Combining Flp-FRT and Cre-loxP systems for highly selective targeting

  • Activity-dependent tagging of GPR50-expressing neurons

  • Genetic access to neurons based on both GPR50 expression and connectivity

In Vivo Manipulation Technologies:

  • DREADD (Designer Receptors Exclusively Activated by Designer Drugs) systems in GPR50-expressing cells

  • Optogenetic control of GPR50-positive neuronal populations

  • Fiber photometry to monitor activity of GPR50-expressing cells in vivo

These advanced transgenic approaches enable unprecedented precision in analyzing GPR50's tissue-specific functions and their relevance to physiological and pathological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.