Recombinant Sheep NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ND3

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) represents one of the 13 protein-coding genes found in the mitochondrial genome of sheep (Ovis aries). It serves as a critical component of Complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain, which catalyzes the first step in electron transport during oxidative phosphorylation, a process fundamental to cellular energy production .

Recombinant Sheep MT-ND3 refers specifically to the artificially produced version of this protein created through molecular cloning techniques, where the genetic code for sheep MT-ND3 is inserted into an expression vector and produced in a host organism, typically Escherichia coli. This recombinant form allows researchers to study the protein's properties outside of its native environment and in quantities sufficient for detailed biochemical and structural analyses.

In the sheep mitochondrial genome, MT-ND3 is encoded on the heavy strand of the circular mitochondrial DNA (mtDNA), which is consistent with the organization observed in other mammals . The complete mitochondrial genome of sheep is a compact and efficiently organized circular molecule ranging from 16,613 to 16,617 bp in different breeds, containing 22 tRNA genes, 2 rRNA genes, 13 protein-coding genes (including MT-ND3), and 1 control region (D-loop) .

Gene Structure and Organization

The sheep MT-ND3 gene is embedded within the mitochondrial genome alongside other protein-coding genes. The organization of sheep mitochondrial genomes is similar across different breeds, with the gene arrangements and transcriptional directions resembling typical Ovis aries mitogenomes . The nucleotide composition of sheep mitochondrial genomes exhibits a bias toward adenine (A) and thymine (T), which affects the coding characteristics of all mitochondrial genes, including MT-ND3 .

Coding Features

A distinctive feature of the sheep MT-ND3 gene is its start codon, which is ATA, unlike many other mitochondrial genes that utilize ATG as the start codon . Additionally, MT-ND3 is inferred to end with an incomplete stop codon (T--), which requires post-transcriptional polyadenylation to form a functional UAA stop codon . This characteristic is shared with several other mitochondrial genes in sheep, including ND1, ND2, ATP6, COX3, and ND4 .

Table 1: Coding Features of Sheep MT-ND3 and Other Mitochondrial Genes

FeatureMT-ND3Other Mitochondrial Genes
Start CodonATAATG (most genes), ATA (ND2, ND5)
Stop CodonIncomplete (T--)Incomplete (T--) for ND1, ND2, ATP6, COX3, ND4; TAA for others
Coding StrandHeavyHeavy (12 genes), Light (ND6 and 8 tRNA genes)
Nucleotide BiasA/T-richA/T-rich across all genes with variable content

Structure and Conservation

While the specific amino acid sequence of sheep MT-ND3 is not fully detailed in available research, we can infer its characteristics based on the conserved nature of this protein across mammalian species. MT-ND3 typically consists of approximately 115 amino acids, forming a small but crucial component of Complex I . The protein contains a conserved loop region that plays a significant role in the functional regulation of Complex I .

The conserved ND3 loop is involved in the active/deactive state transition of Complex I, a regulatory mechanism that helps protect against excessive reactive oxygen species production under stress conditions . This structural feature highlights the functional importance of MT-ND3 in mitochondrial energy metabolism.

Functional Significance

Mutations in the MT-ND3 gene can significantly impact Complex I function and have been associated with various mitochondrial disorders. Research on MT-ND3 in mouse models has demonstrated that specific mutations in the conserved regions can lead to alterations in Complex I activity, potentially resulting in metabolic dysfunction .

Expression Systems and Purification

Recombinant MT-ND3 production typically involves expressing the protein in Escherichia coli, with the addition of fusion tags such as His-tags to facilitate purification . While specific protocols for sheep MT-ND3 are not detailed in the available research, methodologies employed for similar mitochondrial proteins can be adapted.

The purification process generally includes affinity chromatography, taking advantage of the fusion tags, followed by quality assessment using techniques such as SDS-PAGE. Recombinant MT-ND3 proteins typically achieve purities greater than 90% .

Mitochondrial Base Editing

Recent advancements in genetic engineering have enabled targeted modifications of mitochondrial genes, including MT-ND3. Research using DddA-derived cytosine base editors (DdCBE) has demonstrated successful in vivo editing of mouse MT-Nd3, targeting specific cytosine residues in the conserved regions of the gene . This technology has significant implications for studying MT-ND3 function and potentially developing treatments for mitochondrial disorders.

In one study, researchers designed base editing systems targeting the mouse MT-Nd3 gene at mtDNA positions m.9576 G and m.9577 G by targeting the complementary cytosine residues . The targeted mutations were located in the conserved ND3 loop involved in the active/deactive state transition of Complex I, demonstrating efficient editing of the target cytosines with editing efficiencies of 10-30% in cardiac tissue .

Mitochondrial DNA Transmission Studies

Studies on mitochondrial DNA in sheep clones have provided insights into the inheritance patterns of mitochondrial genes, including MT-ND3. Research has documented cases of mitochondrial DNA heteroplasmy (presence of multiple mtDNA types) in ovine fetuses and cloned sheep, with varying degrees of donor mtDNA contribution .

In a study examining sheep clones, seven heteroplasmic individuals were identified among twelve screened, with most cases showing less than 1% mtDNA contribution from the nuclear donor cell . One exceptional case exhibited high-level heteroplasmy (6.8% to 46.5%), possessing a divergent recipient oocyte-derived mtDNA genotype with rare amino acid changes . These findings contribute to our understanding of mitochondrial genetics and the transmission of mitochondrial genes in reproductive technologies.

Cross-Species Conservation

MT-ND3 exhibits significant conservation across mammalian species, reflecting its fundamental role in mitochondrial function. While specific comparisons between sheep MT-ND3 and that of other species are not fully detailed in the available research, the conservation of functional elements, such as the ND3 loop involved in Complex I regulation, underscores the evolutionary constraints on this protein .

Mitochondrial Genome Diversity in Sheep

These genomic analyses contribute to our understanding of sheep genetic resources and provide a foundation for investigating the evolutionary relationships between Chinese breeds of Ovis aries and those developed in other countries . The conservation of MT-ND3 within these diverse genomic backgrounds highlights its essential role in mitochondrial function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it for prioritized development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function

Recombinant Sheep NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor. MT-ND3 is essential for the catalytic activity of Complex I.

Database Links

KEGG: oas:808255

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what role does it play in mitochondrial function?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to belong to the minimal assembly required for catalysis of electron transfer from NADH to the respiratory chain. The protein functions specifically in the transfer of electrons from NADH to ubiquinone, which serves as the immediate electron acceptor for the enzyme . As a component of Complex I, MT-ND3 contributes to the proton-pumping activity that establishes the electrochemical gradient necessary for ATP synthesis, making it crucial for cellular energy production. Mutations in MT-ND3 can result in dysfunctional Complex I, leading to various mitochondrial diseases including Leigh syndrome .

How is sheep MT-ND3 encoded and what are its characteristics?

Sheep MT-ND3 is encoded by the mitochondrial genome (mtDNA), specifically by the MT-ND3 gene. Like other mitochondrially-encoded proteins, it is synthesized within the mitochondria using the organelle's own transcription and translation machinery . The protein consists of 115 amino acids and contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane. The gene has several synonyms including MTND3, NADH3, and ND3 . The protein demonstrates high specificity in detection assays, with minimal cross-reactivity observed with analogous proteins . The MT-ND3 protein sequence is relatively conserved across mammalian species, though some variations exist that may affect functional properties in different organisms.

What detection methods are available for sheep MT-ND3 in laboratory settings?

Several methods are available for detecting sheep MT-ND3 in research settings:

  • ELISA assays: Sandwich ELISA techniques using antibodies specific for MT-ND3 provide quantitative measurement of the protein. The typical protocol involves coating microplates with anti-MT-ND3 antibody, adding samples, then applying a biotin-conjugated secondary antibody specific for MT-ND3, followed by streptavidin-HRP and substrate . This method offers high sensitivity and specificity for sheep MT-ND3.

  • PCR-based methods: ARMS-PCR (Amplification Refractory Mutation System-PCR) can be used to detect and quantify mutations in MT-ND3 genes. This technique employs specific primers designed to differentially amplify wild-type versus mutant sequences .

  • Mass spectrometry: Electrospray mass spectrometry can identify MT-ND3 protein within complex mixtures such as isolated mitochondrial fractions or purified Complex I preparations .

  • Two-dimensional gel electrophoresis: This technique can fractionate mitochondrial proteins, allowing for the isolation and identification of MT-ND3 when combined with subsequent protein digestion and peptide sequencing .

What are optimal expression systems for producing recombinant sheep MT-ND3?

Based on available research data, the optimal expression systems for recombinant sheep MT-ND3 production include:

E. coli Expression System: This appears to be the most commonly used system for producing recombinant MT-ND3. When expressing MT-ND3 in E. coli, several considerations should be taken into account:

  • Codon optimization: The mitochondrial genetic code differs from the standard code used by E. coli. Therefore, codon optimization of the MT-ND3 sequence is necessary to ensure efficient translation in the bacterial host .

  • Fusion tags: The addition of N-terminal His-tags has proven successful in facilitating purification while maintaining protein functionality . Based on similar approaches with elephant MT-ND3, a His-tag fusion strategy appears effective for sheep MT-ND3 as well.

  • Expression conditions: Reduced temperature (16-20°C) during induction phase often improves the solubility of membrane proteins like MT-ND3. IPTG concentrations of 0.1-0.5 mM are typically used for induction.

  • Solubilization strategy: As MT-ND3 is a highly hydrophobic membrane protein with multiple transmembrane domains, proper solubilization using mild detergents (DDM, LDAO, or Triton X-100) is crucial for maintaining native conformation.

  • Reconstitution approach: For functional studies, reconstitution into liposomes or nanodiscs may be necessary to recreate the membrane environment required for proper protein folding and activity.

How can researchers quantify and analyze MT-ND3 heteroplasmy in experimental models?

Quantifying heteroplasmy (the mixture of wild-type and mutant mtDNA) in MT-ND3 requires sensitive and specific methodologies:

  • ARMS-PCR method: This approach can detect point mutations such as T10158C in mtDNA. The method employs a common forward primer binding to the MT-ND3 gene sequence and two types of reverse primers: a wild-type (WT) primer and a mutant (MT) primer. These primers are designed with a specific mismatch at the 3' terminal side to differentially detect the wild-type versus mutant sequences .

  • Quantitative calculation: The mutation rate (heteroplasmy level) can be calculated using the formula:

    Mutation rate (%)=Amount of MT geneAmount of MT gene + Amount of WT gene×100\text{Mutation rate (\%)} = \frac{\text{Amount of MT gene}}{\text{Amount of MT gene + Amount of WT gene}} \times 100

  • Standard curve development: For accurate quantification, a standard curve should be created by mixing plasmid DNA encoding the target wild-type gene and the mutant gene (e.g., pT7-WT-mRNA (ND3), pT7-MT-mRNA (ND3)) at various ratios (0-100%), followed by quantitative ARMS-PCR . The ideal standard curve should show a slope of approximately 1, indicating that the experimental values closely match the theoretical values.

  • Next-generation sequencing (NGS): For more precise quantification, NGS technologies can be employed. This approach allows for quantitative analysis of heteroplasmic mutant load by counting the number of mtDNA reads. The sequenced reads are mapped to the reference mitochondrial genome (e.g., NC_012920 for human) using alignment tools like Burrows-Wheeler Aligner, and variants are identified using the Genome Analysis Toolkit .

What therapeutic strategies target MT-ND3 mutations in mitochondrial diseases?

Current research demonstrates several therapeutic approaches targeting MT-ND3 mutations:

  • Mitochondrial mRNA delivery: A promising strategy involves the delivery of wild-type MT-ND3 mRNA to mitochondria in diseased cells to decrease the mutation rate. This approach utilizes specially designed delivery systems like MITO-Porter that can transport therapeutic nucleic acids into mitochondria .

  • mRNA design considerations: When designing therapeutic MT-ND3 mRNA, several modifications from the native sequence must be considered:

    • Changing the start codon from ATA to ATG to ensure proper translation initiation

    • Inclusion of polyadenylation signals to enhance mRNA stability

    • Optimization of codon usage for mitochondrial translation machinery

  • Validation protocol: To validate the efficacy of MT-ND3 RNA therapeutics, a stepwise procedure should be followed:

    • Transfection of cells with the delivery vehicle containing therapeutic mRNA

    • Washing with appropriate buffers to remove surface-bound delivery vehicles

    • Cell homogenization and mitochondrial isolation

    • RNase treatment to remove extramitochondrial RNA

    • Total RNA extraction from isolated mitochondria

    • Reverse transcription to prepare cDNA

    • Quantitative ARMS-PCR to determine mutation rates before and after treatment

What are optimal protocols for sheep MT-ND3 ELISA assays?

The optimal protocol for sheep MT-ND3 ELISA includes the following key steps and considerations:

  • Principle of the assay: The sandwich ELISA technique employs a microplate pre-coated with an antibody specific for MT-ND3. Standards and samples are added to the wells, allowing any MT-ND3 present to bind to the immobilized antibody .

  • Step-by-step protocol:

    • Add 100 μL of standards or samples to appropriate wells

    • Incubate at 37°C for 90 minutes

    • Remove liquid and add 100 μL of biotin-conjugated detection antibody

    • Incubate at 37°C for 60 minutes

    • Wash 3 times with wash buffer

    • Add 100 μL of streptavidin-HRP conjugate

    • Incubate at 37°C for 30 minutes

    • Wash 5 times with wash buffer

    • Add 90 μL of substrate solution

    • Incubate in the dark at 37°C for 15-25 minutes

    • Add 50 μL of stop solution

    • Read absorbance at 450 nm within 5 minutes

  • Quality control parameters:

    • Establish a standard curve using serial dilutions of recombinant sheep MT-ND3

    • Include blank, negative control, and positive control samples in each assay

    • Technical replicates (at least duplicates) should be performed for each sample

    • Calculate intra-assay and inter-assay coefficients of variation (<10% and <15%, respectively)

  • Assay optimization considerations:

    • Sample preparation: Different tissue types may require specific extraction protocols to optimize MT-ND3 recovery

    • Antibody specificity: Validate absence of cross-reactivity with other NADH dehydrogenase subunits

    • Incubation conditions: Temperature and duration may need adjustment based on sample type

How can researchers verify the structural and functional integrity of recombinant MT-ND3?

Verifying the structural and functional integrity of recombinant MT-ND3 requires multiple analytical approaches:

  • Structural verification:

    • SDS-PAGE: Should show a single band at approximately 13 kDa, with purity >90%

    • Western blotting: Using specific antibodies against MT-ND3 or the His-tag

    • Circular dichroism (CD) spectroscopy: To assess secondary structure elements, particularly the alpha-helical content expected for this membrane protein

    • Mass spectrometry: To confirm the exact molecular weight and potential post-translational modifications

  • Functional verification:

    • Complex I assembly assay: Determining whether recombinant MT-ND3 can incorporate into native Complex I when introduced into mitochondrial preparations

    • NADH oxidation activity: Measuring NADH:ubiquinone oxidoreductase activity using spectrophotometric methods

    • Membrane reconstitution studies: Evaluating proper folding and orientation in artificial membrane systems

  • Verification data interpretation:

    Verification MethodExpected ResultsPotential Issues
    SDS-PAGESingle band at ~13 kDaMultiple bands indicate degradation or contamination
    CD SpectroscopyHigh alpha-helical contentLow helical content suggests misfolding
    NADH OxidationActivity comparable to native Complex IReduced activity indicates functional impairment
    Complex I AssemblyIntegration into Complex I structureFailure to integrate suggests structural defects

How should researchers analyze MT-ND3 mutation data in relation to mitochondrial disease phenotypes?

When analyzing MT-ND3 mutation data in relation to disease phenotypes, researchers should consider:

  • Heteroplasmy threshold effects: The clinical manifestation of MT-ND3 mutations often depends on the percentage of mutated mtDNA. Different tissues may have different threshold levels for exhibiting dysfunction. Analysis should include:

    • Quantification of mutation load across different tissues

    • Correlation of heteroplasmy levels with tissue-specific symptoms

    • Establishment of threshold values for phenotypic expression

  • Genotype-phenotype correlations:

    • Compile comprehensive clinical data including age of onset, progression rate, and symptom constellation

    • Analyze MT-ND3 mutations in relation to specific clinical features (e.g., epilepsy in Leigh syndrome)

    • Compare disease severity across patients with identical mutations but varying heteroplasmy levels

  • Functional impact assessment:

    • Analyze how specific mutations affect protein structure using molecular modeling

    • Measure Complex I activity in patient samples or model systems

    • Correlate biochemical defects with clinical severity

  • Statistical approaches:

    • Use multivariate analysis to identify factors that modify phenotypic expression

    • Apply machine learning algorithms to identify patterns in complex genotype-phenotype datasets

    • Employ survival analysis for progressive conditions associated with MT-ND3 mutations

What are the best experimental controls for MT-ND3 research?

Robust experimental design for MT-ND3 research requires appropriate controls:

  • Genetic controls:

    • Wild-type MT-ND3 sequences from the same species

    • Site-directed mutagenesis controls with known functional consequences

    • Heteroplasmy controls with defined mixtures of wild-type and mutant DNA/RNA

  • Expression system controls:

    • Empty vector controls for recombinant expression systems

    • Host cells without transfection/transformation

    • Mock-transfected/transformed controls

  • Functional assay controls:

    • Positive controls: Known functional MT-ND3 or Complex I preparations

    • Negative controls: Samples with specific Complex I inhibitors (e.g., rotenone)

    • Technical controls: Identical samples processed through different methodological variations

  • Validation controls for therapeutic interventions:

    • Untreated disease models

    • Models treated with non-specific or scrambled nucleic acids

    • Dose-response controls to establish therapeutic thresholds

What emerging technologies may advance sheep MT-ND3 research?

Several cutting-edge technologies show promise for advancing sheep MT-ND3 research:

  • CRISPR/Cas9 mitochondrial genome editing: Though challenging due to the unique properties of mitochondrial genetics, recent advances in mitochondrial genome editing could allow precise manipulation of MT-ND3 sequences to create disease models or test genetic therapies.

  • Single-cell mitochondrial transcriptomics: This approach could reveal cell-to-cell variations in MT-ND3 expression and mutation burden, providing insights into tissue-specific pathologies.

  • Mitochondria-targeted mRNA therapeutics: Building on existing research , more sophisticated delivery systems and mRNA designs could improve the efficacy of MT-ND3 replacement strategies.

  • Cryo-electron microscopy: Higher-resolution structural studies of Complex I containing sheep MT-ND3 could reveal species-specific features and functional mechanisms not apparent in current models.

  • Organoid models: Developing sheep-derived organoids with controlled MT-ND3 mutations could provide more physiologically relevant systems for studying tissue-specific effects and testing therapeutic interventions.

How do MT-ND3 variants contribute to species-specific mitochondrial function?

Understanding species-specific variations in MT-ND3 could provide valuable insights:

  • Comparative sequence analysis: Detailed examination of MT-ND3 sequences across species reveals evolutionary conservation patterns and potentially functionally important variations. For example, comparison between sheep and elephant MT-ND3 (115 amino acids in both species) could identify domain-specific adaptations related to metabolic requirements.

  • Functional impact of variations: Species-specific MT-ND3 variations likely contribute to differences in:

    • Complex I efficiency and electron transfer rates

    • Reactive oxygen species production

    • Response to environmental stressors and toxins

    • Metabolic adaptation to different ecological niches

  • Research approach: To investigate these aspects, researchers should consider:

    • Recombinant expression of MT-ND3 variants from different species

    • Creation of chimeric proteins to identify functional domains

    • Measurement of bioenergetic parameters in cells expressing different MT-ND3 variants

    • Computational modeling of species-specific structural variations and their impact on Complex I dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.