Recombinant Sheep NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

MT-ND4L is a core subunit of Complex I, the largest enzyme in the electron transport chain (ETC). Its primary functions include:

  • Electron Transfer: Mediates the transfer of electrons from NADH to ubiquinone, reducing it to ubiquinol .

  • Proton Pumping: Conformational changes during electron transport drive the translocation of protons across the mitochondrial membrane, contributing to ATP synthesis .

  • Structural Stability: Maintains the integrity of Complex I’s transmembrane region, enabling efficient energy production .

Production and Applications

Recombinant MT-ND4L is synthesized via heterologous expression systems:

Production MethodHost SystemPurityKey Applications
Bacterial ExpressionE. coli>85% (SDS-PAGE)Structural studies, ELISA kits, antibody validation
Yeast ExpressionSaccharomyces cerevisiae>85%Functional assays, protein-protein interaction studies
Mammalian Cell ExpressionHEK293/CHO cellsHigh purityNative conformation studies, therapeutic research

Applications:

  • ELISA Kits: Quantitative detection of MT-ND4L in research samples (e.g., sandwich ELISA with streptavidin-HRP conjugates) .

  • Antibody Development: Polyclonal antibodies (e.g., rabbit anti-MT-ND4L) for Western blotting and immunohistochemistry .

  • Structural Biology: Crystallization studies to map interactions in Complex I .

Disease Associations

Mutations in MT-ND4L have been linked to:

  • Leber’s Hereditary Optic Neuropathy (LHON): A T→C mutation at position 10,663 disrupts Complex I function, impairing ATP production in retinal cells .

  • Metabolic Disorders: Variants correlate with increased BMI, obesity, and insulin resistance .

Research Findings

  • Gene Overlap: The MT-ND4L gene overlaps with MT-ND4 in a +3 reading frame, a unique feature of mitochondrial DNA .

  • Oxidative Stress: Complex I dysfunction due to MT-ND4L mutations increases reactive oxygen species (ROS), damaging mtDNA and exacerbating disease .

  • Therapeutic Targets: Recombinant MT-ND4L is used to study Complex I assembly and develop therapies for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Please note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MSLVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Recombinant Sheep NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Database Links

KEGG: oas:808256

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the normal function of MT-ND4L in cellular metabolism?

MT-ND4L (NADH dehydrogenase 4L) is a crucial component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. This protein facilitates the first step in the electron transport process by transferring electrons from NADH to ubiquinone. As part of Complex I, MT-ND4L is embedded in the inner mitochondrial membrane and contributes to establishing the electrochemical gradient necessary for ATP production through oxidative phosphorylation. The protein plays an essential role in cellular energy metabolism by helping to convert the energy from food into ATP, which serves as the cell's primary energy source .

The MT-ND4L protein works in concert with other subunits to create an unequal electrical charge across the inner mitochondrial membrane through electron transfer. This charge difference provides the energy required for ATP synthesis, making MT-ND4L vital for cellular respiration and energy production in tissues with high metabolic demands .

How does sheep MT-ND4L differ from its homologs in other species?

Sheep MT-ND4L maintains the core functional domains necessary for electron transport while exhibiting species-specific variations in amino acid sequences. These variations, while preserving the protein's fundamental role in the respiratory chain, may contribute to differences in enzyme efficiency or stability under various physiological conditions. Despite these species-specific differences, the protein's association with Complex I and its role in the initial electron transfer from NADH to ubiquinone remains conserved across species .

The study of sheep MT-ND4L provides valuable insights into mitochondrial function in agricultural animals and serves as an important comparative model for understanding mitochondrial genetics and biochemistry across mammalian species. Researchers have noted its sequence conservation in critical functional domains while identifying species-specific variations that may reflect evolutionary adaptation to different metabolic demands .

What are the alternative nomenclatures and identifiers for MT-ND4L in scientific literature?

MT-ND4L is known by several alternative names in scientific databases and literature, which can sometimes create confusion for researchers. The protein may be referenced as:

  • NADH dehydrogenase subunit 4L (mitochondrion)

  • NADH-ubiquinone oxidoreductase chain 4L

  • NADH dehydrogenase subunit 4L

The gene encoding this protein is known as MT-ND4L, with synonyms including MTND4L, NADH4L, and ND4L. In scientific databases and literature, these various nomenclatures may be used interchangeably, requiring researchers to recognize all variants when conducting literature searches or database queries .

What are the optimal conditions for working with recombinant sheep MT-ND4L protein?

When working with recombinant sheep MT-ND4L, storage and handling conditions significantly impact protein stability and experimental reliability. The protein should be stored at -20°C for regular use, while extended storage requires -80°C conditions to maintain structural integrity. Repeated freeze-thaw cycles should be avoided as they can compromise protein function. For short-term work, keeping working aliquots at 4°C for up to one week is recommended .

The recombinant protein is typically supplied in liquid form containing glycerol, which acts as a cryoprotectant. When designing experiments, researchers should consider the E. coli expression system used for production, as this may introduce specific considerations for downstream applications. Additionally, when incorporating the protein into experimental systems, researchers should account for the protein's natural membrane-embedded state by including appropriate detergents or membrane-mimicking environments to maintain proper protein folding and function .

What PCR protocols are effective for amplifying MT-ND4L from sheep samples?

For effective amplification of sheep MT-ND4L from biological samples, researchers have successfully employed specific primer pairs with optimized annealing temperatures. According to validated protocols, the following primers have proven reliable for MT-ND4L amplification:

Forward primer: 5'-TCACAGTATCCCTCACAGGACT-3'
Reverse primer: 5'-CTCGCAAGCTGCGAAAACTA-3'

The optimal annealing temperature for these primers is 55°C, as demonstrated in published research. For reference, the NCBI Reference Sequence XR_003587932.1 can be used to design alternative primers if needed .

The PCR amplification protocol typically involves initial denaturation at 95°C for 3 minutes, followed by 35-40 cycles of denaturation (95°C, 30 seconds), annealing (55°C, 30 seconds), and extension (72°C, 30-45 seconds), with a final extension at 72°C for 5 minutes. This protocol has been validated in studies examining MT-ND4L expression in sheep oocytes and can be adapted for various tissue types with appropriate optimization of extraction methods and PCR conditions .

How can researchers effectively measure MT-ND4L expression levels in sheep tissues?

Quantification of MT-ND4L expression in sheep tissues requires careful selection of reference genes and normalized quantification approaches. RT-qPCR has been effectively employed using the primers specified in question 2.2, with GAPDH (NCBI Reference Sequence: NM_001190390) serving as a reliable housekeeping gene for normalization. The following GAPDH primers have been validated for this purpose:

Forward primer: 5'-GGTTGTCTCCTGCGACTTCA-3'
Reverse primer: 5'-CAGGGCCTTGAGGATGGAAA-3'

How are mutations in MT-ND4L associated with Leber hereditary optic neuropathy?

A specific mutation in the MT-ND4L gene has been identified in several families with Leber hereditary optic neuropathy (LHON). This mutation, designated as T10663C or Val65Ala, results in a single amino acid substitution where valine is replaced by alanine at position 65 of the protein. While the precise mechanism by which this mutation leads to the characteristic vision loss in LHON remains incompletely understood, it likely disrupts the normal functioning of Complex I in the mitochondrial respiratory chain .

The substitution at position 65 may alter the protein's interaction with other Complex I components or affect electron transfer efficiency, potentially leading to increased reactive oxygen species (ROS) production. The resulting oxidative stress appears to preferentially affect retinal ganglion cells, which have high energy demands and are particularly sensitive to mitochondrial dysfunction. This selective vulnerability explains the predominant visual symptoms characteristic of LHON. Research using recombinant sheep MT-ND4L as a model system may provide further insights into the structural and functional consequences of this mutation .

What role does MT-ND4L dysfunction play in mitochondrial diseases beyond LHON?

Beyond LHON, MT-ND4L dysfunction has implications for broader mitochondrial pathologies due to its essential role in Complex I functionality. When MT-ND4L function is compromised, the efficiency of electron transfer through Complex I decreases, potentially leading to several consequences: reduced ATP production, increased ROS generation, and disrupted calcium homeostasis. These disturbances can contribute to various tissue-specific manifestations of mitochondrial disease .

Research using sheep models has demonstrated that mitochondrial dysfunction involving NADH dehydrogenase components like MT-ND4L may affect reproductive biology, particularly oocyte quality and maturation. Studies have shown that measures to improve mitochondrial function, such as Mito-TEMPO supplementation, can enhance meiotic competence by suppressing ROS accumulation, regulating ATP production, and maintaining calcium homeostasis in mitochondria. These findings suggest that MT-ND4L's role extends to cellular processes critical for development and reproduction, highlighting its significance beyond neurodegenerative conditions like LHON .

How does MT-ND4L contribute to the ubiquinone binding site in Complex I?

Recent photoaffinity labeling studies using biotinylated ubiquinone mimics have provided insights into ubiquinone binding sites in NADH-quinone oxidoreductases. While these studies focused primarily on NDH-2 type enzymes rather than Complex I specifically, they reveal important principles about quinone-protein interactions that may apply to MT-ND4L. Research has identified that the ubiquinone ring binds to specific protein regions in close proximity to the FAD cofactor, facilitating electron transfer .

In Complex I, MT-ND4L likely contributes to forming the ubiquinone binding pocket through specific amino acid residues that interact with the quinone head group or its isoprenoid tail. The protein's transmembrane domains may help position ubiquinone optimally for electron acceptance from iron-sulfur clusters. Understanding these interactions is crucial for explaining how mutations in MT-ND4L can disrupt electron transport and energy production. Further structural studies using recombinant sheep MT-ND4L could help elucidate the precise contribution of this subunit to ubiquinone binding and electron transfer in Complex I .

What is the significance of MT-ND4L in maintaining mitochondrial membrane potential?

MT-ND4L plays a critical role in maintaining mitochondrial membrane potential (ΔΨm) through its function in Complex I. By facilitating electron transfer from NADH to ubiquinone, MT-ND4L contributes to proton pumping across the inner mitochondrial membrane, which establishes the electrochemical gradient necessary for ATP synthesis. Research on sheep oocytes has demonstrated that proper function of mitochondrial components, including MT-ND4L, is essential for maintaining optimal membrane potential .

Studies have shown that mitochondrial dysfunction involving respiratory chain components can lead to decreased membrane potential, which correlates with reduced ATP production and increased ROS generation. The addition of mitochondria-targeted antioxidants like Mito-TEMPO can help preserve membrane potential under stress conditions, suggesting that oxidative damage to components like MT-ND4L may compromise membrane potential. Measuring ΔΨm using fluorescent probes such as JC-1 or TMRM provides valuable insights into how MT-ND4L mutations or dysfunction affect this critical parameter of mitochondrial health .

How does MT-ND4L expression change under oxidative stress conditions?

What are the key considerations when designing experiments using recombinant sheep MT-ND4L?

When designing experiments with recombinant sheep MT-ND4L, researchers must address several critical considerations to ensure reliable and reproducible results. First, the protein's native membrane environment must be accounted for, as MT-ND4L functions as part of Complex I embedded in the inner mitochondrial membrane. Appropriate detergents, lipid nanodiscs, or membrane-mimicking systems should be employed to maintain proper protein folding and function .

Second, researchers should carefully consider the expression system used to produce the recombinant protein. The E. coli-expressed protein from commercial sources lacks post-translational modifications present in the native sheep protein, which may affect certain interactions or functions. Additionally, storage conditions significantly impact protein stability—storage at -20°C or -80°C is recommended, with minimal freeze-thaw cycles. Working aliquots should be kept at 4°C for no more than one week to preserve functional integrity .

Finally, experimental design should include appropriate controls to account for batch-to-batch variation in recombinant protein preparations. Positive controls with known activity and negative controls with denatured protein can help validate experimental outcomes. For functional studies, researchers should consider that MT-ND4L normally operates as part of a multi-subunit complex, and isolated protein may exhibit different properties than when incorporated into the complete Complex I structure .

What analytical techniques are most effective for studying MT-ND4L interactions with other Complex I components?

Several analytical techniques have proven valuable for investigating MT-ND4L interactions within Complex I. Photoaffinity labeling using synthetic ubiquinone analogs has successfully identified binding regions in related proteins, suggesting this approach could be adapted for MT-ND4L studies. This technique involves synthesizing photoreactive quinone derivatives that can form covalent bonds with nearby amino acids upon UV irradiation, allowing subsequent identification of interaction sites through mass spectrometry .

Co-immunoprecipitation coupled with western blotting can identify direct protein-protein interactions between MT-ND4L and other Complex I subunits. For structural studies, cryo-electron microscopy has emerged as a powerful tool for visualizing membrane protein complexes like respiratory chain components at near-atomic resolution. Additionally, hydrogen-deuterium exchange mass spectrometry can map protein interaction surfaces by measuring the accessibility of different protein regions to solvent .

Functional interaction studies may employ site-directed mutagenesis of key residues followed by activity assays measuring electron transfer rates or membrane potential. Blue native polyacrylamide gel electrophoresis can assess complex assembly and stability when specific interactions are disrupted. Together, these complementary approaches provide a comprehensive understanding of how MT-ND4L contributes to Complex I structure and function through its interactions with other components .

How can researchers effectively study the impact of MT-ND4L mutations on mitochondrial function?

To effectively study the impact of MT-ND4L mutations on mitochondrial function, researchers should implement a multi-parameter assessment approach. First, site-directed mutagenesis can be used to introduce specific mutations (such as the T10663C associated with LHON) into expression constructs. These mutant constructs can then be expressed in suitable cell models, ideally those with reduced or absent endogenous MT-ND4L expression .

For functional analysis, researchers should measure several key parameters:

  • Complex I enzyme activity using spectrophotometric assays that monitor NADH oxidation rates

  • Mitochondrial membrane potential using fluorescent probes like JC-1 or TMRM

  • ATP production using luminescence-based assays

  • ROS generation using specific fluorescent indicators

  • Oxygen consumption rates using respirometry

Additional insights can be gained by analyzing mitochondrial morphology and distribution using confocal or super-resolution microscopy. Calcium imaging can reveal effects on mitochondrial calcium handling, which has been shown to be affected by respiratory chain dysfunction .

For in vivo relevance, researchers may consider generating animal models with the mutation of interest, although this approach is more challenging. Alternatively, patient-derived cells carrying MT-ND4L mutations can provide clinically relevant insights. The use of mitochondria-targeted antioxidants like Mito-TEMPO in experimental protocols may help distinguish primary effects of the mutation from secondary consequences of oxidative stress .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.